Sequence 1: | NP_612032.1 | Gene: | CG1231 / 38060 | FlyBaseID: | FBgn0035134 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001341635.1 | Gene: | Krcc1 / 57896 | MGIID: | 1889377 | Length: | 256 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 41/199 - (20%) |
---|---|---|---|
Similarity: | 65/199 - (32%) | Gaps: | 61/199 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 DLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAHDR-HISAWLAKNYTEVGL 143
Fly 144 EAPPVK-RLAKQ-----GPTGPNAFHCELCNLDLT---SSMHARQHYLGRKHKRVEQGVAK---- 195
Fly 196 PSGAR--------------------HCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSD 240
Fly 241 DNER 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1231 | NP_612032.1 | C2H2 Zn finger | 104..163 | CDD:275371 | 12/65 (18%) |
zf-met | 104..126 | CDD:289631 | 3/21 (14%) | ||
zf-met | 163..186 | CDD:289631 | 6/25 (24%) | ||
C2H2 Zn finger | 164..186 | CDD:275371 | 5/24 (21%) | ||
UFD2 | 255..>338 | CDD:227443 | |||
ZnF_U1 | 304..336 | CDD:197732 | |||
Krcc1 | NP_001341635.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 62..84 | 7/36 (19%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 144..256 | 20/100 (20%) | |||
MIP-T3 | 146..>236 | CDD:313469 | 19/98 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167838287 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |