| Sequence 1: | NP_612032.1 | Gene: | CG1231 / 38060 | FlyBaseID: | FBgn0035134 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001341635.1 | Gene: | Krcc1 / 57896 | MGIID: | 1889377 | Length: | 256 | Species: | Mus musculus |
| Alignment Length: | 199 | Identity: | 41/199 - (20%) |
|---|---|---|---|
| Similarity: | 65/199 - (32%) | Gaps: | 61/199 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 80 DLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAHDR-HISAWLAKNYTEVGL 143
Fly 144 EAPPVK-RLAKQ-----GPTGPNAFHCELCNLDLT---SSMHARQHYLGRKHKRVEQGVAK---- 195
Fly 196 PSGAR--------------------HCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSD 240
Fly 241 DNER 244 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1231 | NP_612032.1 | C2H2 Zn finger | 104..163 | CDD:275371 | 12/65 (18%) |
| zf-met | 104..126 | CDD:289631 | 3/21 (14%) | ||
| zf-met | 163..186 | CDD:289631 | 6/25 (24%) | ||
| C2H2 Zn finger | 164..186 | CDD:275371 | 5/24 (21%) | ||
| UFD2 | 255..>338 | CDD:227443 | |||
| ZnF_U1 | 304..336 | CDD:197732 | |||
| Krcc1 | NP_001341635.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 62..84 | 7/36 (19%) | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 144..256 | 20/100 (20%) | |||
| MIP-T3 | 146..>236 | CDD:313469 | 19/98 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167838287 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||