DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1231 and Krcc1

DIOPT Version :9

Sequence 1:NP_612032.1 Gene:CG1231 / 38060 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001341635.1 Gene:Krcc1 / 57896 MGIID:1889377 Length:256 Species:Mus musculus


Alignment Length:199 Identity:41/199 - (20%)
Similarity:65/199 - (32%) Gaps:61/199 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAHDR-HISAWLAKNYTEVGL 143
            |..|..|.:.|||.         :|.      :|:...|......|||: .:::.....:|..|.
Mouse    60 DQRLPSGTNHSYPR---------SCS------SSQTEDRVPQWLPAHDKIRLNSLSYCQFTRDGF 109

  Fly   144 EAPPVK-RLAKQ-----GPTGPNAFHCELCNLDLT---SSMHARQHYLGRKHKRVEQGVAK---- 195
            ...||. .|::|     ..:..:..|..||:...|   ...|.:.|...:||  ||:|..|    
Mouse   110 SEKPVPLNLSQQEYNCGSYSVESVVHKRLCSEHSTIDPQVSHRQMHQKRKKH--VEEGREKQEER 172

  Fly   196 PSGAR--------------------HCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSD 240
            |...|                    ..:|...:.|...|..:.|..|:|..:          |.:
Mouse   173 PKHERKRSSEEMDLNKHRSIQRKKTKAETETVQDGTEKLKNRKEKKTRDVSS----------KKE 227

  Fly   241 DNER 244
            |.:|
Mouse   228 DRKR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 12/65 (18%)
zf-met 104..126 CDD:289631 3/21 (14%)
zf-met 163..186 CDD:289631 6/25 (24%)
C2H2 Zn finger 164..186 CDD:275371 5/24 (21%)
UFD2 255..>338 CDD:227443
ZnF_U1 304..336 CDD:197732
Krcc1NP_001341635.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..84 7/36 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..256 20/100 (20%)
MIP-T3 146..>236 CDD:313469 19/98 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.