DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and zgc:114104

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_021324566.1 Gene:zgc:114104 ZFINID:ZDB-GENE-050913-63 Length:582 Species:Danio rerio

Alignment Length:308 Identity:66/309 (21%)
Similarity:113/309 (37%) Gaps:64/309 (21%)


  Fly    68 KCMEEDSLKANGDLALFPGRDESYPEELNRLIGPLN-------------CQLCKVQMTSRKRARD 119
            :|.|.|.:|...|:.  |...::....::::.|..|             |.:|:..:....:...
Zfish    13 QCAETDHIKNTDDIN--PEIVQNTNTNISQVEGTQNDDNLLKGLLTDSFCHVCEASLIHESQRVS 75

  Fly   120 HYESKAHDRHISAWLAKNYTE-----------VGLEAPPVKRLAKQGPTGPNAFHCELCNLDLTS 173
            |||.|.|.:.:..:|.|....           :||.|..               .||:|::..:|
Zfish    76 HYEGKKHAQRVRMYLNKKAKMNKQRQESEGLLIGLSAEK---------------FCEMCSMVFSS 125

  Fly   174 SMHARQHYLGRKH-KRVEQGVAKPSGARHCDTS--VGRYGIGSLFRKPESLTKDSPTDVLISENS 235
            ...|:.||.|:.| |.:.:....|........:  .....|.|.......:|::......:::..
Zfish   126 PTVAKSHYEGKVHAKNMRKNNVPPPRVLPAPVTEPTAPIAIPSEVPVQNQVTQEQKDTSGLADQG 190

  Fly   236 VIKSDDNERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAPIPETEKLDAAELALY 300
            |..||.| :.|.||.....:....|.|.:|.:||:|  .:|||......     ||.:.|     
Zfish   191 VDLSDPN-KYCPLCSASFNNPLVAQQHYSGRKHQRN--QARQDMLDQMG-----EKSEQA----- 242

  Fly   301 RTPMGQYYCQPCNMMMNHESTLQQHFIGKKHL---KRVKNLSQTEKNV 345
                ....|..|.:.::.....|.|..|.|||   |:|.:|.:::|.|
Zfish   243 ----SSLTCPICCLTLSSIEMYQSHMQGNKHLIKEKKVIDLCKSQKKV 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 12/70 (17%)
zf-met 104..126 CDD:289631 6/22 (27%)
zf-met 163..186 CDD:289631 8/23 (35%)
C2H2 Zn finger 164..186 CDD:275371 8/22 (36%)
UFD2 255..>338 CDD:227443 22/86 (26%)
ZnF_U1 304..336 CDD:197732 10/35 (29%)
zgc:114104XP_021324566.1 zf-U1 59..>115 CDD:328948 12/71 (17%)
ZnF_U1 114..144 CDD:197732 10/45 (22%)
ZnF_U1 195..229 CDD:197732 12/37 (32%)
C2H2 Zn finger 200..222 CDD:275371 6/22 (27%)
C2H2 Zn finger 247..269 CDD:275371 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89508702
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 1 1.000 T128793
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.