DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and zmat3

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_005155912.1 Gene:zmat3 ZFINID:ZDB-GENE-130530-881 Length:361 Species:Danio rerio

Alignment Length:314 Identity:72/315 (23%)
Similarity:110/315 (35%) Gaps:110/315 (35%)


  Fly    71 EEDSLKANGDLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAHDRHISAWLA 135
            |||:.....|       .|:..|||.:   ||.|:||.|.:.|.::|:.||:.|.|.:.:     
Zfish   115 EEDAQAVAAD-------QEATLEELCK---PLYCKLCNVTLNSAQQAQAHYQGKNHSKKL----- 164

  Fly   136 KNYTEVGLEAPPVKRLAKQGPTGPNAFHCELCNLDLTSSMHARQHYLGRKHKRVEQGVAKPSGAR 200
            :|:.....:.||:        |.|..                           ||....:||...
Zfish   165 RNFYAGSQQPPPI--------TIPEV---------------------------VEPVSQQPSATT 194

  Fly   201 HCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSDDNERTCHLCKIVVTSAAQMQAHLAG 265
            ..|::      .:...:|  |||.:...:|.:||..         |.||....:|.|..|||..|
Zfish   195 PTDSA------NATANQP--LTKGASRVILATENDY---------CKLCDASFSSPAVAQAHYQG 242

  Fly   266 ARHQKNWRTSRQDQNHSEAPIPETEKLDAAE---------------------------------- 296
            ..|.|..|.:...||.:.:.:.:|::....|                                  
Zfish   243 KNHAKRLRLAEAQQNATSSDLSDTQRRPRKEGYEYRLMKNRRAQFNTAMPGPYYNPRPRQRIPRD 307

  Fly   297 LALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRV---------KNLSQT 341
            ||:..||.||:||..||...:.|:..:.|...|:|..||         :||..|
Zfish   308 LAMCVTPSGQFYCSMCNSGASEEAEFRLHLESKQHKSRVSEQRYRSEMENLGYT 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 15/59 (25%)
zf-met 104..126 CDD:289631 9/22 (41%)
zf-met 163..186 CDD:289631 0/23 (0%)
C2H2 Zn finger 164..186 CDD:275371 0/22 (0%)
UFD2 255..>338 CDD:227443 30/126 (24%)
ZnF_U1 304..336 CDD:197732 12/41 (29%)
zmat3XP_005155912.1 ZnF_U1 133..167 CDD:197732 13/42 (31%)
C2H2 Zn finger 138..160 CDD:275371 9/22 (41%)
ZnF_U1 218..251 CDD:197732 14/42 (33%)
C2H2 Zn finger 223..245 CDD:275371 9/22 (41%)
ZnF_U1 315..349 CDD:197732 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89557995
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128793
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46786
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5774
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.