DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and znf346

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001075218.1 Gene:znf346 ZFINID:ZDB-GENE-070209-152 Length:301 Species:Danio rerio

Alignment Length:287 Identity:65/288 (23%)
Similarity:105/288 (36%) Gaps:73/288 (25%)


  Fly    78 NGDLALFPGRDESYPEELNRLI-------GPLNCQLCKVQMTSRKRARDHYESKAHDRHISAWLA 135
            |||....|    |...|:||:|       ....|::|...:.|..:...||:||.|...:..:::
Zfish    28 NGDFPYLP----SGAAEVNRMIKENSDLFSDSQCKVCSAVLISESQKLAHYQSKKHASKVRRYMS 88

  Fly   136 KNYTEVGLEAPPVKRLAKQGPTGPNAFH------CELCNLDLTSSMHARQHYLGRKHKRVEQGVA 194
            .:    |.|.|..||....|....|...      |.:||:..:|.:.|:.||.|:.|.:      
Zfish    89 IH----GSEEPIAKRFKPSGDDQSNVDEKDKYKACSVCNMTFSSPVVAQSHYQGKVHSK------ 143

  Fly   195 KPSGARHCDTSVGRYGIGS---LFRKPESLTK-----DSPTDVLISENSVIKSDDNERTCHLCKI 251
                      ::....|||   ...:||:..|     ..|.:           .|..|.|.:|:.
Zfish   144 ----------NLRMQSIGSQTPALPQPEAQAKKDDGMQGPAE-----------QDPNRFCSICQA 187

  Fly   252 VVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAPIPETEKLDAAELALYRTPMGQYYCQPCNMMM 316
            ...:....|.|.:|.:|:|:....:..:....:..|.:            |..| |.|..||:.:
Zfish   188 SFNNPLMAQQHYSGKKHKKHMNKQKLMETFGPSTAPAS------------TVKG-YPCTVCNIEL 239

  Fly   317 NHESTLQQHFIGKKHLKRVKNLSQTEK 343
            |.....|.|..|.||    ||.::.:|
Zfish   240 NSVEQYQAHISGSKH----KNHAKPKK 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 15/59 (25%)
zf-met 104..126 CDD:289631 7/22 (32%)
zf-met 163..186 CDD:289631 8/29 (28%)
C2H2 Zn finger 164..186 CDD:275371 8/22 (36%)
UFD2 255..>338 CDD:227443 20/83 (24%)
ZnF_U1 304..336 CDD:197732 11/32 (34%)
znf346NP_001075218.1 ZnF_U1 57..86 CDD:197732 8/29 (28%)
C2H2 Zn finger 57..79 CDD:275371 7/22 (32%)
ZnF_U1 119..148 CDD:197732 9/45 (20%)
C2H2 Zn finger 119..141 CDD:275371 8/22 (36%)
ZnF_U1 177..211 CDD:197732 9/34 (26%)
C2H2 Zn finger 182..204 CDD:275371 5/22 (23%)
C2H2 Zn finger 232..254 CDD:275371 8/22 (36%)
zf-met 232..254 CDD:289631 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89531265
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5217
OMA 1 1.010
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 1 1.000 T128793
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.