DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and zmat3

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001017144.1 Gene:zmat3 XenbaseID:XB-GENE-1014344 Length:291 Species:Xenopus tropicalis

Alignment Length:373 Identity:79/374 (21%)
Similarity:121/374 (32%) Gaps:150/374 (40%)


  Fly     1 MSCPGSL----RGFHIPHLAPGETPKIRVDSACIESHPDAEISTSNRLVAPGKRTDKKDNGSIRT 61
            ::||.||    |...||         |.:.|.  :|..:|..|||..:                |
 Frog    16 IACPSSLGIDKRQIMIP---------IAIQSQ--KSPINASHSTSLEV----------------T 53

  Fly    62 NMKRKAKCMEEDSLKANGDLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAH 126
            ..:..||.:|:|                   ..|..|..||:|:||.|.:.|.::|:.||:.|.|
 Frog    54 QDEELAKVLEQD-------------------PSLEDLCRPLSCKLCNVTLNSAQQAQAHYQGKNH 99

  Fly   127 DRHISAWLAKNYTEVGLEAPPVKRLAKQGPTGPNAFHCELCNLDLTSSMHARQHYLGRKHKRVEQ 191
            ::.:..:.|.:      ..|...||:.              .|::||                  
 Frog   100 NKKLRNYCASS------SCPASSRLSH--------------TLEMTS------------------ 126

  Fly   192 GVAKPSGARHCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSDDNERTCHLCKIVVTSA 256
                |......:||..:.| |.:              :|.:||..         |.||....:|.
 Frog   127 ----PQTVSSLNTSSTKVG-GRV--------------ILATENDY---------CKLCDASFSSP 163

  Fly   257 AQMQAHLAGARHQKNWR------------------TSRQDQNHSEAPI----------------P 287
            ...|||..|..|.|..|                  |.::...|...|:                |
 Frog   164 VVAQAHYQGKNHAKRLRLAETPANCFMDSAECKRKTRKEGNEHKMMPMRRNACTVQNSTGPYFNP 228

  Fly   288 ETEKLDAAELALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRV 335
            .:.:....:||:..||.||:||..||...:.|...:||...|:|..:|
 Frog   229 RSRQRIPRDLAMCVTPSGQFYCSMCNAGASEELEFRQHLETKQHKSKV 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 14/59 (24%)
zf-met 104..126 CDD:289631 9/22 (41%)
zf-met 163..186 CDD:289631 3/23 (13%)
C2H2 Zn finger 164..186 CDD:275371 3/22 (14%)
UFD2 255..>338 CDD:227443 28/116 (24%)
ZnF_U1 304..336 CDD:197732 12/33 (36%)
zmat3NP_001017144.1 ZnF_U1 72..106 CDD:197732 12/34 (35%)
C2H2 Zn finger 77..99 CDD:275371 9/22 (41%)
ZnF_U1 148..181 CDD:197732 13/42 (31%)
C2H2 Zn finger 153..175 CDD:275371 8/22 (36%)
ZnF_U1 245..279 CDD:197732 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89560808
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T129308
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5774
TreeFam 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.