DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and KRCC1

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001291455.1 Gene:KRCC1 HGNCID:28039 Length:259 Species:Homo sapiens

Alignment Length:211 Identity:38/212 (18%)
Similarity:71/212 (33%) Gaps:37/212 (17%)


  Fly    89 ESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEAPPVKRLAK 153
            :|:.:||...|.....:..:.:...||...|:.|:..:...:::            .|..:...:
Human     9 DSFQDELEDYIKVQKARGLEPKTCFRKMKGDYLETCGYKGEVNS------------RPTYRMFDQ 61

  Fly   154 QGPTGPNAFHCELCNLDLTSSMHARQHYLGRKHKRVEQGV-AKPSGARHCDTSVGRYGIGSLFRK 217
            :.|:.....:...||:..|            ...|:.|.: |..|..|....|..::.......|
Human    62 RLPSETIQTYPRSCNIPQT------------VENRLPQWLPAHDSRLRLDSLSYCQFTRDCFSEK 114

  Fly   218 PESLTKDSPTDVLIS---ENSVIK--SDDNERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQ 277
            |..|..:....:..|   |:.|.|  |.||..:.|       .|:..|.|....||.:..|...:
Human   115 PVPLNFNQQEYICGSHGVEHRVYKHFSSDNSTSTH-------QASHKQIHQKRKRHPEEGREKSE 172

  Fly   278 DQNHSEAPIPETEKLD 293
            ::..........|::|
Human   173 EERSKHKRKKSCEEID 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 6/59 (10%)
zf-met 104..126 CDD:289631 4/22 (18%)
zf-met 163..186 CDD:289631 3/23 (13%)
C2H2 Zn finger 164..186 CDD:275371 3/22 (14%)
UFD2 255..>338 CDD:227443 8/40 (20%)
ZnF_U1 304..336 CDD:197732
KRCC1NP_001291455.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89468564
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.