DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and CG11586

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001261410.1 Gene:CG11586 FlyBaseID:FBgn0035520 Length:194 Species:Drosophila melanogaster

Alignment Length:97 Identity:22/98 (22%)
Similarity:39/98 (40%) Gaps:29/98 (30%)


  Fly   114 RKRARDHYESKAHDRHISAWLAKNYTEVGLEAPPVKR---------------------LAKQGPT 157
            ||..::.||..|.:|.::....|       |..||:|                     :.|..||
  Fly    10 RKWDKNEYEKLAAERLLNQVAPK-------EEEPVQRENLKRRDYKVDLDSKLGKSVVINKNTPT 67

  Fly   158 GPN-AFHCELCNLDLTSSMHARQHYLGRKHKR 188
            ..: .::|.:|:..:..|::...|..|:||:|
  Fly    68 SQSGGYYCNVCDCVVKDSINFLDHINGKKHQR 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 14/71 (20%)
zf-met 104..126 CDD:289631 5/12 (42%)
zf-met 163..186 CDD:289631 6/23 (26%)
C2H2 Zn finger 164..186 CDD:275371 6/22 (27%)
UFD2 255..>338 CDD:227443
ZnF_U1 304..336 CDD:197732
CG11586NP_001261410.1 ZnF_U1 70..101 CDD:197732 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89309955
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.