DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and znf385b

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_021334290.1 Gene:znf385b ZFINID:ZDB-GENE-030616-154 Length:532 Species:Danio rerio

Alignment Length:432 Identity:81/433 (19%)
Similarity:134/433 (31%) Gaps:186/433 (43%)


  Fly    69 CME-EDSLKANGDLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAHDRHI-- 130
            |:| ::...||.|:.|        .:|..:|:..| |.:|.:|:.|..:|:.||..|:|.:.:  
Zfish    29 CVEVKEPTNANVDMQL--------QQEKKKLLYSL-CDVCNIQLHSAAQAQVHYNGKSHLKRVKQ 84

  Fly   131 ---------SAWLAKN-----------------------------YTEVGLEAPPVKR--LAKQG 155
                     ||.||..                             ..:.||:..|...  :....
Zfish    85 LNNGEVPKASASLAPTSLQSLSSSSSQGSSCHSNTLPTLVRTPSLMMQSGLDMKPFMTFPVESSS 149

  Fly   156 PTG--PN--------------------------AFHCELCNLDLTSSMHARQHYLGRKH------ 186
            |.|  ||                          ...|.:|.|...|...|..||.|.||      
Zfish   150 PVGLFPNFNTMDPVQKAVINHTFGVSIPPKKKQVISCNICQLRFNSDSQAEAHYKGSKHAKKLKA 214

  Fly   187 -----KRVEQGVAKPSGAR---------------------------------------------- 200
                 .:.:..||:.||.:                                              
Zfish   215 QESPKNKQKSAVAQDSGTKTITSTSTNTTTTTTTSSCTAVTASCSDQTEKSTEPLAAHKVPASPQ 279

  Fly   201 -----------------------HCDTSVGRYGIGSLFR---KPESLTKDSPTDVLISENSVIKS 239
                                   |........|:....:   ||.:|    ||  ..||.||...
Zfish   280 AFVPAPVAPAVALVPSPCKTAPVHASPPTEPTGLAVALKNTSKPAAL----PT--APSEPSVESE 338

  Fly   240 DDNERT---CHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAPIPETEKLDAAELALYR 301
            ::..:.   |.|||:.|.|.:|::||..|::|    :|..:.:| ...||....: ..::|.:..
Zfish   339 EEKAKKLLYCSLCKVAVNSLSQLEAHNTGSKH----KTMLEARN-GAGPIKAYPR-PGSKLKVQA 397

  Fly   302 TPMGQ--------YYCQPCNMMMNHESTLQQHFIGKKHLKRV 335
            |.:.:        ::|:.|::.:|.|..|:||...::|..||
Zfish   398 TQLNKGSGLQNKTFHCEICDVHVNSEIQLKQHISSRRHKDRV 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 20/129 (16%)
zf-met 104..126 CDD:289631 8/22 (36%)
zf-met 163..186 CDD:289631 9/23 (39%)
C2H2 Zn finger 164..186 CDD:275371 9/22 (41%)
UFD2 255..>338 CDD:227443 22/90 (24%)
ZnF_U1 304..336 CDD:197732 10/41 (24%)
znf385bXP_021334290.1 ZnF_U1 56..85 CDD:197732 9/29 (31%)
C2H2 Zn finger 186..208 CDD:275371 9/22 (41%)
zf-met 186..208 CDD:315537 9/22 (41%)
zf-met 346..370 CDD:315537 10/24 (42%)
C2H2 Zn finger 348..370 CDD:275371 10/22 (45%)
zf-met 411..435 CDD:315537 7/24 (29%)
C2H2 Zn finger 413..435 CDD:275371 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89544547
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.