DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and CG17098

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_609430.1 Gene:CG17098 FlyBaseID:FBgn0032276 Length:652 Species:Drosophila melanogaster

Alignment Length:319 Identity:93/320 (29%)
Similarity:143/320 (45%) Gaps:72/320 (23%)


  Fly    57 GSIRTNMKRKAKCME----EDSL--KANGDLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRK 115
            |.|..:::.:...:|    ::||  ..|.||||........|::|..|.....|.||.:.:.|.:
  Fly   361 GFIPNHLQSRVAMVEPRIRQESLIKPQNPDLALPSEAHPPVPQDLQSLFRWNYCALCNMVIRSTQ 425

  Fly   116 RARDHYESKAHDRHISAWLAK----NYTEVGLEAPPVKRLAKQGPTGPNAFHCELCNLDLTSSMH 176
            .|.|||.|:||:|.||:||.:    |.|  |.:|.     |..|....:.|:|:||:|.|||..|
  Fly   426 SAIDHYSSRAHERRISSWLVRKCYANLT--GRDAD-----ALGGAISQSEFYCKLCDLKLTSLSH 483

  Fly   177 ARQHYLGRKHKRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSDD 241
            |:||:|||:|:         ..|||   .:..:..|...|                |.:.:::|.
  Fly   484 AQQHFLGRRHR---------IAARH---RIRPFSDGFYDR----------------EGNWVRTDI 520

  Fly   242 NERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTS------------------------RQDQNHS 282
            ....|.||.:::||.:||..|||||||::..:.:                        |...|.|
  Fly   521 KYPMCELCDVIITSESQMAMHLAGARHRRRVQIAYAGESAGGMEMGIGLVPFDGSHMYRIRGNGS 585

  Fly   283 EAPIPE--TEKLDAAELALYRT-PMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRVKNL 338
            .|||..  ::.|..:...|..| |...:||..||:.:||..::.||..|:.|.:.:..|
  Fly   586 LAPIRPLGSQLLQGSAYPLSLTDPSAVFYCDACNITLNHLKSVNQHEQGRMHRRNMHRL 644

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 23/63 (37%)
zf-met 104..126 CDD:289631 10/22 (45%)
zf-met 163..186 CDD:289631 14/23 (61%)
C2H2 Zn finger 164..186 CDD:275371 14/22 (64%)
UFD2 255..>338 CDD:227443 30/110 (27%)
ZnF_U1 304..336 CDD:197732 10/32 (31%)
CG17098NP_609430.1 zf-met 524..547 CDD:289631 13/23 (57%)
ZnF_U1 613..640 CDD:197732 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133987370
eggNOG 1 0.900 E1_2CKPU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46786
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.