DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zmat4

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_006509202.1 Gene:Zmat4 MGIID:2443497 Length:243 Species:Mus musculus

Alignment Length:249 Identity:65/250 (26%)
Similarity:98/250 (39%) Gaps:51/250 (20%)


  Fly   104 CQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEAPPVKRLAKQGPTGPNAFH----C 164
            |::|..|:.|..:...||||:.|...:..:...:..:.|.   |.|||..:..:..:...    |
Mouse    30 CKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGC---PAKRLRAENGSDADMVDKNKCC 91

  Fly   165 ELCNLDLTSSMHARQHYLGRKH-KRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTKDSPTD 228
            .|||:..||::.|..||.|:.| ||::.                     .|..||...|..:|..
Mouse    92 TLCNMSFTSAVVADSHYQGKIHAKRLKL---------------------LLGEKPPLKTTAAPLS 135

  Fly   229 VL----ISENSVIKSD----DNERTCHLCKIVVTSAAQMQAHLAGARHQKN-WRTSRQDQNHSEA 284
            .|    :....|:.|.    |::|.|.||.....:....|.|..|.:|:|| .|.:..:|..:  
Mouse   136 SLKAPRVDTAPVVASPYQRRDSDRYCGLCAAWFNNPLMAQQHYEGKKHKKNAARVALLEQLGT-- 198

  Fly   285 PIPETEKLDAAEL-ALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRVKN 337
                  .||..|| .|.||    |.|..|::.:|.......|..|.||...:||
Mouse   199 ------SLDLGELRGLRRT----YRCTTCSVSLNSIEQYHAHLQGSKHQTNLKN 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 14/59 (24%)
zf-met 104..126 CDD:289631 8/22 (36%)
zf-met 163..186 CDD:289631 10/27 (37%)
C2H2 Zn finger 164..186 CDD:275371 10/22 (45%)
UFD2 255..>338 CDD:227443 25/86 (29%)
ZnF_U1 304..336 CDD:197732 8/32 (25%)
Zmat4XP_006509202.1 zf-met 29..52 CDD:289631 8/22 (36%)
C2H2 Zn finger 30..52 CDD:275371 8/22 (36%)
ZnF_U1 86..120 CDD:197732 13/55 (24%)
C2H2 Zn finger 91..113 CDD:275371 10/22 (45%)
ZnF_U1 156..190 CDD:197732 12/34 (35%)
C2H2 Zn finger 161..183 CDD:275371 6/22 (27%)
C2H2 Zn finger 214..236 CDD:275371 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89521429
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5276
Isobase 1 0.950 0 Normalized mean entropy S7931
OMA 1 1.010
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 1 1.000 T131030
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5774
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.