DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Krcc1

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001009413.1 Gene:Krcc1 RGDID:1306495 Length:256 Species:Rattus norvegicus

Alignment Length:266 Identity:50/267 (19%)
Similarity:82/267 (31%) Gaps:84/267 (31%)


  Fly    89 ESYPEELNRLIGPLNCQLCKVQ-------MTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEAP 146
            :|:.:||...|        |||       .|..:|.|..|....           .|.|.....|
  Rat     9 DSFQDELEDYI--------KVQKARGLEPKTCFRRMRGEYLESC-----------GYREEFDSRP 54

  Fly   147 PVKRLAKQGPTGPNAFHCELCNLDLTSSMHARQHYLGRKHKRVEQGVAKPSGARHCDTSVGRYGI 211
            ..:...::.|:|.|..:...|:...|..             ||.|.:......|....:..::..
  Rat    55 RYRMFDQRIPSGTNHSYPRSCSSSQTED-------------RVPQWLPAHDKIRLNSLNYCQFTR 106

  Fly   212 GSLFRKPES--LTKDSPTDVLISENSVIKSDDNERTCHLC---KIVVTSAAQMQAHLAGARHQKN 271
            .....||.|  |::........|..||:..|       ||   ..:....:..|.:....||.:.
  Rat   107 DGFSEKPVSLNLSQQEYNCGSYSVESVVHKD-------LCSGHSTIDPQVSHRQMYQKRKRHLEE 164

  Fly   272 WRTSRQDQNHSEAPIPETEKLDAAELALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRVK 336
            .| .||::.      |:.|:..::|                      |..|.:|    |.::|.|
  Rat   165 GR-ERQEER------PKHERKRSSE----------------------EMDLNKH----KSIQRKK 196

  Fly   337 NLSQTE 342
            ..::||
  Rat   197 TKAETE 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 13/66 (20%)
zf-met 104..126 CDD:289631 7/29 (24%)
zf-met 163..186 CDD:289631 2/23 (9%)
C2H2 Zn finger 164..186 CDD:275371 2/22 (9%)
UFD2 255..>338 CDD:227443 15/83 (18%)
ZnF_U1 304..336 CDD:197732 5/32 (16%)
Krcc1NP_001009413.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89468623
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.