DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zfp385b

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_017447189.1 Gene:Zfp385b RGDID:1311181 Length:497 Species:Rattus norvegicus

Alignment Length:429 Identity:80/430 (19%)
Similarity:129/430 (30%) Gaps:182/430 (42%)


  Fly    62 NMKRKAKCMEEDSLKANGDLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAH 126
            ||....:..||..||.:.     ||  :.:.:|..:::... |.:|.:|:.|..:|:.||:.|:|
  Rat     2 NMASFLRGFEEKGLKNDR-----PG--DQFSKEKKKILFSF-CDVCNIQLNSAAQAQVHYDGKSH 58

  Fly   127 DRHISAWLAKNYTEVGLEAPP----VKRLA----------------------------------- 152
            .:.:     |..:: |...||    |..||                                   
  Rat    59 RKRV-----KQLSD-GQPPPPAQGSVPLLASPCPGPGPGPGTNTSTGSACHTTTLPALVRTPTLM 117

  Fly   153 ------------------------------KQGPTGPNAF------------------------- 162
                                          ::|..|.|.|                         
  Rat   118 MQPSLDIKPFMSFPVDSSSAVGLFPNFNTKRRGLFGTNKFFQMDPVQKAVINHTFGVSIPPKKKQ 182

  Fly   163 --HCELCNLDLTSSMHARQHYLGRKH--------------------------------------- 186
              .|.:|.|...|...|..||.|.||                                       
  Rat   183 VISCNVCQLRFNSDSQAEAHYTGSKHAKKVKALEATKNKPKMVPSKDSAKANPSCSVRPGTGDSS 247

  Fly   187 -KRVEQGVAKPSGARHCDTSVGRYGIGSLFRK-------------PESLTKDSPTDVLISENSVI 237
             |..::|..|.:.:.....|.|    ||.|.|             |...|..:|..|..||....
  Rat   248 DKSEDKGKIKATSSSQPSGSEG----GSFFLKSGTTPLTLGAIASPSKSTNGAPGSVAESEEEKA 308

  Fly   238 KSDDNERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAPIPETEKLDAAELALYRT 302
            |   ....|.|||:.|.|.:|::||..|::|:     :..:..:...||....: ..:.|.:...
  Rat   309 K---KLLYCSLCKVAVNSLSQLEAHNTGSKHK-----TMVEARNGAGPIKSYPR-PGSRLKVQNG 364

  Fly   303 PMGQ------YYCQPCNMMMNHESTLQQHFIGKKHLKRV 335
            ..|.      ::|:.|::.:|.|..|:||...::|..||
  Rat   365 SKGSGLQNKTFHCEICDVHVNSEIQLKQHISSRRHKDRV 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 20/155 (13%)
zf-met 104..126 CDD:289631 8/22 (36%)
zf-met 163..186 CDD:289631 9/23 (39%)
C2H2 Zn finger 164..186 CDD:275371 9/22 (41%)
UFD2 255..>338 CDD:227443 20/88 (23%)
ZnF_U1 304..336 CDD:197732 11/39 (28%)
Zfp385bXP_017447189.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89549124
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.846 Consistency score
TreeFam 1 0.960
32.800

Return to query results.
Submit another query.