DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zfp346

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_006253690.1 Gene:Zfp346 RGDID:1308068 Length:306 Species:Rattus norvegicus

Alignment Length:265 Identity:67/266 (25%)
Similarity:104/266 (39%) Gaps:63/266 (24%)


  Fly    86 GRDE-SYPEELNR-LIGPLNCQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEA--P 146
            ||:| .:..:.|: |.....|::|...:.|..:...||:||.|...:..:||.:    |:|.  .
  Rat    67 GREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIH----GMETLKG 127

  Fly   147 PVKRL---AKQGPTGPNAFHCELCNLDLTSSMHARQHYLGRKHKR---VEQGVAKPSGARHCDTS 205
            .||||   .|...:......|.:||:..:|.:.|:.||||:.|.|   ::|..||  ||      
  Rat   128 DVKRLDSDQKSSRSKDKNHCCPVCNMTFSSPVVAQSHYLGKTHARNLKLKQQPAK--GA------ 184

  Fly   206 VGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSDDNERTCHLCKIVVTSAAQMQAHLAGARHQK 270
                   :|.:..|:|                   |.::.|.||.......|..|.|..|.||:|
  Rat   185 -------ALQQHRETL-------------------DPDKFCSLCHSAFNDPAMAQQHYTGKRHRK 223

  Fly   271 NWRTSRQDQNHSEAPIPETEKLDAAELALYRTPMGQ-YYCQPCNMMMNHESTLQQHFIGKKHLKR 334
            .....:...::.....|....          :|.|: |.|:.|.:::|.....|.|..|.||   
  Rat   224 QETKLKLMAHYGRLAGPTASD----------SPAGKGYPCKTCKIVLNSIEQYQAHVSGFKH--- 275

  Fly   335 VKNLS 339
             ||.|
  Rat   276 -KNQS 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 17/64 (27%)
zf-met 104..126 CDD:289631 7/22 (32%)
zf-met 163..186 CDD:289631 9/23 (39%)
C2H2 Zn finger 164..186 CDD:275371 9/22 (41%)
UFD2 255..>338 CDD:227443 21/84 (25%)
ZnF_U1 304..336 CDD:197732 10/33 (30%)
Zfp346XP_006253690.1 ZnF_U1 87..116 CDD:197732 8/29 (28%)
C2H2 Zn finger 87..109 CDD:275371 7/22 (32%)
ZnF_U1 143..176 CDD:197732 11/33 (33%)
C2H2 Zn finger 148..170 CDD:275371 9/22 (41%)
ZnF_U1 194..228 CDD:197732 11/34 (32%)
C2H2 Zn finger 199..221 CDD:275371 8/22 (36%)
C2H2 Zn finger 253..275 CDD:275371 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89534976
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5228
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 1 1.000 T618802
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.