DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zfp385d

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_017455133.1 Gene:Zfp385d RGDID:1359606 Length:531 Species:Rattus norvegicus

Alignment Length:394 Identity:78/395 (20%)
Similarity:132/395 (33%) Gaps:133/395 (34%)


  Fly    48 GKRTDKKDNGSIRTNMKRKAKCMEEDSLKANGDLALFPGRDESYPEELNRLIGPLNCQLCKVQMT 112
            |.|.|...|.:...:.:.:|:.|              ||..|..||:..:......|.:|.:|:.
  Rat    63 GFRKDTSGNFASAQDGESEAEIM--------------PGEFEERPEQEKKHSNFTFCSVCNIQLN 113

  Fly   113 SRKRARDHYESKAHDRHISAWLAKNYTE-------------------VGLEAPPVKRLAKQGPTG 158
            |..:|:.||..|:|.:.:     |..|:                   :...|||::......|..
  Rat   114 SATQAQIHYNGKSHQKRL-----KQLTKGVPMSDGGGTCQSPALPALIHPPAPPLQPSLDIKPFL 173

  Fly   159 P---------NAF------------------------------HCELCNLDLTSSMHARQHYLGR 184
            |         |.|                              .|.:|.|...|...|..||.|.
  Rat   174 PFPLDTAATVNLFPNFNAMDPIQKAVINHTFGVPLPHRKKQIISCNICQLRFNSDSQAAAHYKGT 238

  Fly   185 KH----------KRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPES------------LTKDSPT 227
            ||          |..::.|.....|:...||:....|.:...|.||            :.|.|..
  Rat   239 KHAKKLKALESMKNKQKSVTAKDSAKTTFTSITTNPITTSSDKTESTAGTQVIARSADMRKSSEV 303

  Fly   228 DVLISEN------SVIKSDDNERT--------------CHLCKIVVTSAAQMQAHLAGARHQKNW 272
            ...::.|      :.:.:.:|...              |.|||:.|.||:|::||.:|.:|    
  Rat   304 TTELTSNAEKSLTAAVAAGNNSSPPTETEEEKAKRLLYCSLCKVAVNSASQLEAHNSGTKH---- 364

  Fly   273 RTSRQDQNHS-------EAPIPETEKLDAAELALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKK 330
            :|..:.:|.|       .|.:.....::.....|...   .::|:.|::.:|.|:.|:||...::
  Rat   365 KTMLEARNGSGTIKAFPRAGMKGKGPVNKGNTGLQNK---TFHCEICDVHVNSETQLKQHISSRR 426

  Fly   331 HLKR 334
            |..|
  Rat   427 HKDR 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 18/117 (15%)
zf-met 104..126 CDD:289631 8/22 (36%)
zf-met 163..186 CDD:289631 9/23 (39%)
C2H2 Zn finger 164..186 CDD:275371 9/22 (41%)
UFD2 255..>338 CDD:227443 21/88 (24%)
ZnF_U1 304..336 CDD:197732 9/32 (28%)
Zfp385dXP_017455133.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89485863
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
32.800

Return to query results.
Submit another query.