DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zfp385c

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_006220908.1 Gene:Zfp385c RGDID:1563442 Length:503 Species:Rattus norvegicus

Alignment Length:375 Identity:77/376 (20%)
Similarity:114/376 (30%) Gaps:142/376 (38%)


  Fly   104 CQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEAP----PVKRLAKQG-PTGP---- 159
            |.:|.:|:.|..:|:.|...:||.|.:.. |:...|..|...|    |...||... ||.|    
  Rat    45 CDVCNIQLNSAAQAQVHCGGRAHQRRLRQ-LSLGKTSTGPAGPASSAPSPLLASLTLPTQPLQPP 108

  Fly   160 ------NAFH-----------------------------------------CELCNLDLTSSMHA 177
                  .|||                                         |.:|:|...|:..|
  Rat   109 LDLKHLLAFHLNGTTPLSLFPNFSTMDPVQKAVISHTFGVPSPLKKKLFISCNICHLRFNSANQA 173

  Fly   178 RQHYLGRKH----KRVEQGVAK-----------------------PSGARHCDTSVGRYGIG-SL 214
            ..||.|.:|    |.||...:|                       |...:..|.:....|.. .|
  Rat   174 EAHYKGHRHARKLKAVEAAKSKQRPRNLTTNGTVASTASPPASGSPGNPQSKDPASPPRGPSLQL 238

  Fly   215 FRKPESLTKD--------------------------------SPTDVLISE--NSVIKSDDNERT 245
            ...|:..|:|                                .|.:|....  |...:.:.....
  Rat   239 PPTPDPSTRDPAHSELSDAAASSSSSSCPPCSPDPSREAPGPEPAEVAAGNGVNGEGRGEKGRLY 303

  Fly   246 CHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAP------------IPETEKLDAAELA 298
            |..||:.|.||:|:|||..||:|:  |..    :.|..||            .....|.......
  Rat   304 CPTCKVTVNSASQLQAHNTGAKHR--WMV----EGHQGAPRRGRGRPVSRGGTGHKTKRVIGNRG 362

  Fly   299 LYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRV-----KNLSQTEK 343
            ..:.|...::|..|.:.:|.|:.|:||...::|..|:     |:.||..|
  Rat   363 GRQGPNPPFHCALCQLHVNSETQLKQHMSSRRHKDRLAGKPPKSSSQHSK 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 21/74 (28%)
zf-met 104..126 CDD:289631 7/22 (32%)
zf-met 163..186 CDD:289631 9/64 (14%)
C2H2 Zn finger 164..186 CDD:275371 8/22 (36%)
UFD2 255..>338 CDD:227443 25/100 (25%)
ZnF_U1 304..336 CDD:197732 9/37 (24%)
Zfp385cXP_006220908.1 ZnF_U1 45..74 CDD:197732 9/30 (30%)
C2H2 Zn finger 160..182 CDD:275371 8/22 (36%)
zf-met 160..182 CDD:289631 8/22 (36%)
zf-met 303..326 CDD:289631 12/23 (52%)
C2H2 Zn finger 304..372 CDD:275371 19/74 (26%)
zf-met 372..395 CDD:289631 7/23 (30%)
C2H2 Zn finger 373..395 CDD:275371 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89443206
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.