DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zfp385a

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_038894.2 Gene:Zfp385a MGIID:1352495 Length:386 Species:Mus musculus

Alignment Length:278 Identity:62/279 (22%)
Similarity:97/279 (35%) Gaps:102/279 (37%)


  Fly   100 GPL--------NCQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEA-------PPVK 149
            |||        :|.:|:::..|:.:|..||:...|.|.:.          |:||       |.|:
Mouse    64 GPLLKTKRPVISCNVCQIRFNSQSQAEAHYKGNRHARRVK----------GIEAAKTRGREPSVR 118

  Fly   150 RLAKQGPTG---PNAFHCELCNLDLTSSMHARQHYLGRKHKRVEQGVA-KPSGARHCDTSVGRYG 210
            ......|.|   |:.                             .||| :|....:        |
Mouse   119 ESGDPAPAGSIPPSG-----------------------------DGVAPRPVSMEN--------G 146

  Fly   211 IGSLFRKPESLT-KDSPTDVLISENSVIK---------------SDDNERT-----CHLCKIVVT 254
            :|.....||... ..||..|..|...|.|               .::.|:.     |.|||:.|.
Mouse   147 LGPAPGSPEKQPGSPSPPSVPESGQGVTKGEGGTSVPASLPGGSKEEEEKAKRLLYCALCKVAVN 211

  Fly   255 SAAQMQAHLAGARHQKNWRTSRQDQNHSEA------PIPETEKLDAAELALYRTPMGQYYCQPCN 313
            |.:|::||..|.:| |....:|......:|      |.|...:..|.:    ||    ::|:.||
Mouse   212 SLSQLEAHNKGTKH-KTILEARSGLGPIKAYPRLGPPTPGEPEAPAQD----RT----FHCEICN 267

  Fly   314 MMMNHESTLQQHFIGKKH 331
            :.:|.|..|:||...::|
Mouse   268 VKVNSEVQLKQHISSRRH 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 16/69 (23%)
zf-met 104..126 CDD:289631 6/22 (27%)
zf-met 163..186 CDD:289631 0/23 (0%)
C2H2 Zn finger 164..186 CDD:275371 0/22 (0%)
UFD2 255..>338 CDD:227443 23/84 (27%)
ZnF_U1 304..336 CDD:197732 9/29 (31%)
Zfp385aNP_038894.2 C2H2 Zn finger 76..98 CDD:275371 6/22 (27%)
zf-met 76..98 CDD:289631 6/22 (27%)
Necessary for binding to ITPR1, CEBPA and p53/TP53 mRNAs 145..351 39/159 (25%)
zf-met 202..225 CDD:289631 10/23 (43%)
C2H2 Zn finger 203..225 CDD:275371 10/22 (45%)
zf-met 262..285 CDD:289631 8/23 (35%)
C2H2 Zn finger 263..285 CDD:275371 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89409708
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.800

Return to query results.
Submit another query.