DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zfp385c

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_006533551.2 Gene:Zfp385c MGIID:3608347 Length:510 Species:Mus musculus

Alignment Length:339 Identity:73/340 (21%)
Similarity:110/340 (32%) Gaps:108/340 (32%)


  Fly    75 LKANGDLALFPGRDESYPEE---LNRLIG---PL------NCQLCKVQMTSRKRARDHYESKAHD 127
            |.....|:|||......|.:   ::...|   ||      :|.:|.::..|..:|..||:...|.
Mouse   119 LNGTTPLSLFPNFSTMDPVQKAVISHTFGVPSPLKKKLFISCNICHLRFNSANQAEAHYKGHRHA 183

  Fly   128 RHISAWLA-----------KNYTEVGLEAPPVK----RLAKQGPTGP------------------ 159
            |.:.|..|           .|.|.|...:||..    ....:||..|                  
Mouse   184 RKLKAVEAAKSKQRPRNPTTNGTVVSSASPPASGSPGTPQSKGPASPPLGPSLQLPPTPDPSAGD 248

  Fly   160 ------NAFHCELCNLDLTSSMHARQHYLGRKHKRVEQGVAKPSGARHCDTSVGRYGIGSLFRKP 218
                  :..|.|||:...:||                     .|....|.....|...|     |
Mouse   249 PVHSAGDPVHSELCDAAASSS---------------------SSSCPPCSPDPSREAPG-----P 287

  Fly   219 ESLTKDSPTDVLISE--NSVIKSDDNERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNH 281
            |      |.:..:..  |...:.:.....|..||:.|.||:|:|||..||:|:  |..    :.|
Mouse   288 E------PAEGAVGSGVNGEGRGEKGRLYCPTCKVTVNSASQLQAHNTGAKHR--WMV----EGH 340

  Fly   282 SEAP------------IPETEKLDAAELALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKR 334
            ..||            .....|.........:.|...::|..|.:.:|.|:.|:||...::|..|
Mouse   341 QGAPRRGRGRPVSRGGTGHKTKRVIGNRGGRQGPSPPFHCALCQLHVNSETQLKQHMSSRRHKDR 405

  Fly   335 V-----KNLSQTEK 343
            :     |:.||..|
Mouse   406 LAGKPPKSSSQHNK 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 18/98 (18%)
zf-met 104..126 CDD:289631 6/22 (27%)
zf-met 163..186 CDD:289631 6/23 (26%)
C2H2 Zn finger 164..186 CDD:275371 5/22 (23%)
UFD2 255..>338 CDD:227443 25/100 (25%)
ZnF_U1 304..336 CDD:197732 9/37 (24%)
Zfp385cXP_006533551.2 ZnF_U1 45..74 CDD:197732
C2H2 Zn finger 160..182 CDD:275371 6/22 (27%)
zf-met 160..182 CDD:289631 6/22 (27%)
zf-met 310..333 CDD:289631 12/23 (52%)
C2H2 Zn finger 311..379 CDD:275371 19/74 (26%)
AKAP95 378..>445 CDD:282797 13/43 (30%)
zf-met 379..402 CDD:289631 7/23 (30%)
C2H2 Zn finger 380..402 CDD:275371 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89442395
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.800

Return to query results.
Submit another query.