DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zfp346

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_006517322.1 Gene:Zfp346 MGIID:1349417 Length:322 Species:Mus musculus

Alignment Length:332 Identity:79/333 (24%)
Similarity:126/333 (38%) Gaps:80/333 (24%)


  Fly    34 PDAEISTSNRLVAPGKRTDK---KDNGSIRTNMKRKAKCMEEDSLKANGDLALFPGRDESYPEEL 95
            |||..:.......|.|.:::   ::...:|.:.:|..:..|..|           |...:..||:
Mouse    18 PDATDAADPGEAGPYKGSEEPEGREPDGVRFDRERARRLWEAVS-----------GAQPAGREEV 71

  Fly    96 NRLI-------GPLNCQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEA--PPVKRL 151
            ..:|       ....|::|...:.|..:...||:||.|...:..:||.:    |:|.  ..||||
Mouse    72 EHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIH----GMETIKGDVKRL 132

  Fly   152 ---AKQGPTGPNAFHCELCNLDLTSSMHARQHYLGRKHKRVEQGVAKPSGARHCDTSVGRYGIGS 213
               .|...:......|.:||:..:|...|:.||||:.|       ||....:...|         
Mouse   133 DSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTH-------AKSLKLKQQST--------- 181

  Fly   214 LFRKPESLTKDSPTDVLISENSVIKSD----DNERTCHLCKIVVTSAAQMQAHLAGARHQKNWRT 274
               |..:|:|......|::....::.:    |.::.|.||.......|..|.|..|.||:|.   
Mouse   182 ---KGAALSKHLTNPFLVASTLALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQ--- 240

  Fly   275 SRQDQNHSEAPIPETE-KLDA-----AELALYRTPMGQ-YYCQPCNMMMNHESTLQQHFIGKKHL 332
                         ||: ||.|     |:.|:...|.|: |.|:.|.:::|.....|.|..|.|| 
Mouse   241 -------------ETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKH- 291

  Fly   333 KRVKNLS 339
               ||.|
Mouse   292 ---KNQS 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 17/64 (27%)
zf-met 104..126 CDD:289631 7/22 (32%)
zf-met 163..186 CDD:289631 9/23 (39%)
C2H2 Zn finger 164..186 CDD:275371 9/22 (41%)
UFD2 255..>338 CDD:227443 27/90 (30%)
ZnF_U1 304..336 CDD:197732 10/33 (30%)
Zfp346XP_006517322.1 ZnF_U1 87..116 CDD:197732 8/29 (28%)
C2H2 Zn finger 87..109 CDD:275371 7/22 (32%)
ZnF_U1 143..176 CDD:197732 12/40 (30%)
C2H2 Zn finger 148..170 CDD:275371 9/22 (41%)
ZnF_U1 210..244 CDD:197732 13/50 (26%)
C2H2 Zn finger 215..237 CDD:275371 8/22 (36%)
C2H2 Zn finger 269..291 CDD:275371 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89534636
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5276
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 1 1.000 T616679
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.