DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and ZNF385A

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_011536470.1 Gene:ZNF385A HGNCID:17521 Length:419 Species:Homo sapiens

Alignment Length:258 Identity:57/259 (22%)
Similarity:99/259 (38%) Gaps:62/259 (24%)


  Fly   100 GPL--------NCQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEA-------PPVK 149
            |||        :|.:|:::..|:.:|..||:...|.|.:.          |:||       |.|:
Human    97 GPLLKTKRPVISCNICQIRFNSQSQAEAHYKGNRHARRVK----------GIEAAKTRGREPGVR 151

  Fly   150 RLAKQGPTGPNAFHCELCNLDLTSSMHARQHYLGRKHKRVEQGVAKPSGARHCDTSVGRYGIGSL 214
            ......|.|               |.......:..:...:|.|:....|:.  :...|.....|:
Human   152 EPGDPAPPG---------------STPTNGDGVAPRPVSMENGLGPAPGSP--EKQPGSPSPPSI 199

  Fly   215 FRKPESLTK---DSPTDVLISENSVIKSDDNERT--CHLCKIVVTSAAQMQAHLAGARHQKNWRT 274
            ....:.:||   .:|....:...|..:.:..:|.  |.|||:.|.|.:|::||..|.:| |....
Human   200 PETGQGVTKGEGGTPAPASLPGGSKEEEEKAKRLLYCALCKVAVNSLSQLEAHNKGTKH-KTILE 263

  Fly   275 SRQDQNHSEA------PIPETEKLDAAELALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKH 331
            :|......:|      |.|...:..|.:    ||    ::|:.||:.:|.|..|:||...::|
Human   264 ARSGLGPIKAYPRLGPPTPGEPEAPAQD----RT----FHCEICNVKVNSEVQLKQHISSRRH 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 15/66 (23%)
zf-met 104..126 CDD:289631 6/22 (27%)
zf-met 163..186 CDD:289631 1/23 (4%)
C2H2 Zn finger 164..186 CDD:275371 1/22 (5%)
UFD2 255..>338 CDD:227443 23/84 (27%)
ZnF_U1 304..336 CDD:197732 9/29 (31%)
ZNF385AXP_011536470.1 C2H2 Zn finger 109..131 CDD:275371 6/22 (27%)
zf-met 109..131 CDD:289631 6/22 (27%)
zf-met 235..258 CDD:289631 10/23 (43%)
C2H2 Zn finger 236..258 CDD:275371 10/22 (45%)
zf-met 295..318 CDD:289631 8/23 (35%)
C2H2 Zn finger 296..318 CDD:275371 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89410154
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.