DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zfp385b

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_006499518.1 Gene:Zfp385b MGIID:2444734 Length:524 Species:Mus musculus

Alignment Length:449 Identity:81/450 (18%)
Similarity:136/450 (30%) Gaps:195/450 (43%)


  Fly    62 NMKRKAKCMEEDSLKANGDLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAH 126
            ||....:..||..||.:.     ||  :.:.:|..:::... |::|.:|:.|..:|:.||:.|:|
Mouse     2 NMATFLRGFEEKGLKNDR-----PG--DQFSKEKKKILFSF-CEVCNIQLNSAAQAQVHYDGKSH 58

  Fly   127 DRHISAWLAKNYTEVGLEAPPVK------------------------------------------ 149
            .:.:     |..:: |...|||:                                          
Mouse    59 RKRV-----KQLSD-GQPPPPVQGSVPLLAGPCPCPGPGPNTSTGSACHTTTLPALVRTPTLMMQ 117

  Fly   150 -----------------------------------RLAKQGPT-------------------GPN 160
                                               .||.:.||                   |.|
Mouse   118 PSLDIKPFMSFPVDSSSAVGLFPNFNTPSLSVDLCLLALRAPTHTGLRKRPGHLKEKRRGLFGTN 182

  Fly   161 AF---------------------------HCELCNLDLTSSMHARQHYLGRKH----KRVEQGVA 194
            .|                           .|.:|.|...|...|..||.|.||    |.:|....
Mouse   183 KFCQMDPVQKAVINHTFGVSIPPKKKQVISCNVCQLRFNSDSQAEAHYKGSKHAKKVKALEATKN 247

  Fly   195 KPSGARHCDTSVG------RYGIGSLFRKPES--------------------LTKDSPTDVLI-- 231
            ||......|::..      |.|.|....|.|.                    |.|...|.:.:  
Mouse   248 KPKMVPSKDSAKANPSCSIRPGTGDSSDKSEDKGKIKATSSSQPSGSEGGSFLLKSGTTPLPLGA 312

  Fly   232 ----------SENSVIKSDDNERT----CHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHS 282
                      :..||.:|::.:..    |.|||:.|.|.:|::||..|::|:     :..:..:.
Mouse   313 IASPSKSTNGAPGSVAESEEEKAKKLLYCSLCKVAVNSLSQLEAHNTGSKHK-----TMVEARNG 372

  Fly   283 EAPIPETEKLDAAELALYRTPMG------QYYCQPCNMMMNHESTLQQHFIGKKHLKRV 335
            ..||....: ..:.|.:.....|      .::|:.|::.:|.|..|:||...::|..||
Mouse   373 AGPIKSYPR-PGSRLKVQNGSKGSGLQNKMFHCEICDVHVNSEIQLKQHISSRRHKDRV 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 21/182 (12%)
zf-met 104..126 CDD:289631 8/22 (36%)
zf-met 163..186 CDD:289631 9/23 (39%)
C2H2 Zn finger 164..186 CDD:275371 9/22 (41%)
UFD2 255..>338 CDD:227443 20/88 (23%)
ZnF_U1 304..336 CDD:197732 11/39 (28%)
Zfp385bXP_006499518.1 zf-met 35..58 CDD:289631 8/24 (33%)
C2H2 Zn finger 36..58 CDD:275371 8/22 (36%)
C2H2 Zn finger 213..235 CDD:275371 9/22 (41%)
zf-met 213..235 CDD:289631 9/22 (41%)
zf-met 340..363 CDD:289631 10/23 (43%)
C2H2 Zn finger 341..403 CDD:275371 15/68 (22%)
zf-met 403..426 CDD:289631 7/23 (30%)
C2H2 Zn finger 404..426 CDD:275371 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89548746
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.800

Return to query results.
Submit another query.