DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and ZNF346

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_005265917.1 Gene:ZNF346 HGNCID:16403 Length:335 Species:Homo sapiens

Alignment Length:258 Identity:65/259 (25%)
Similarity:102/259 (39%) Gaps:61/259 (24%)


  Fly   104 CQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEA--PPVKRL---AKQGPTGPNAFH 163
            |::|...:.|..:...||:||.|...:..:||.:    |:|.  ...|:|   .|...:......
Human   100 CKVCCALLISESQKLAHYQSKKHANKVKRYLAIH----GMETLKGETKKLDSDQKSSRSKDKNQC 160

  Fly   164 CELCNLDLTSSMHARQHYLGRKHKRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTKDSPTD 228
            |.:||:..:|.:.|:.||||:.|       ||....:...|.|            |:|:|.....
Human   161 CPICNMTFSSPVVAQSHYLGKTH-------AKNLKLKQQSTKV------------EALSKRLTNP 206

  Fly   229 VLISENSVIKSD----DNERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAPIPET 289
            .|::....:..:    |.::.|.||..........|.|..|.:|:|.                ||
Human   207 FLVASTLALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQ----------------ET 255

  Fly   290 E-KLDA-----AELALYRTPMGQ-YYCQPCNMMMNHESTLQQHFIGKKHLKRVKNLSQTEKNV 345
            : ||.|     |:.|:...|.|: |.|:.|.:::|.....|.|..|.||    ||  |:.|.|
Human   256 KLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKH----KN--QSPKTV 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 15/64 (23%)
zf-met 104..126 CDD:289631 7/22 (32%)
zf-met 163..186 CDD:289631 9/23 (39%)
C2H2 Zn finger 164..186 CDD:275371 9/22 (41%)
UFD2 255..>338 CDD:227443 25/90 (28%)
ZnF_U1 304..336 CDD:197732 10/33 (30%)
ZNF346XP_005265917.1 ZnF_U1 96..129 CDD:197732 8/29 (28%)
ZnF_U1 160..189 CDD:197732 12/36 (33%)
C2H2 Zn finger 161..183 CDD:275371 9/22 (41%)
ZnF_U1 223..257 CDD:197732 11/50 (22%)
C2H2 Zn finger 228..250 CDD:275371 6/22 (27%)
C2H2 Zn finger 282..304 CDD:275371 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89534876
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5262
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 1 1.000 T130269
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.