DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and Zmat3

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_033543.2 Gene:Zmat3 MGIID:1195270 Length:290 Species:Mus musculus

Alignment Length:319 Identity:75/320 (23%)
Similarity:107/320 (33%) Gaps:118/320 (37%)


  Fly    65 RKAKCMEEDSLKANGDLALFP----------GRDESYPEELNRLIGPLNCQLCKVQMTSRKRARD 119
            |..:.::....||.|..|..|          |..:|..|||.:   ||.|:||.|.:.|.::|:.
Mouse    26 RSTRTLQLPPQKAFGQEASLPLAGEEDLAKRGEPDSALEELCK---PLFCKLCNVTLNSAQQAQA 87

  Fly   120 HYESKAHDRHISAWLAKNYTEVGLEAPPVKRLAKQGPTGPNAFHCELCNLDLTSSMHARQHYLGR 184
            ||:.|.|.:.:..:.|.|      ..||..|:                     ||:         
Mouse    88 HYQGKNHGKKLRNYYAAN------SCPPPARV---------------------SSV--------- 116

  Fly   185 KHKRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTKDSPTD--VLISENSVIKSDDNERTCH 247
                |.:.||.|                 |...|..:....|..  :|.:||..         |.
Mouse   117 ----VAEPVATP-----------------LVPVPPQVGSCKPGGRVILATENDY---------CK 151

  Fly   248 LCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHS-----EAPIPETEKLDA------------- 294
            ||....:|.|..|||..|..|.|..|.: :.|:||     ||....|.|..:             
Mouse   152 LCDASFSSPAVAQAHYQGKNHAKRLRLA-EAQSHSFSDSAEAGQRRTRKEGSEFKMVATRRNMYP 215

  Fly   295 ------------------AELALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRV 335
                              .:||:..||.||:||..||:....|...:||...|:|..:|
Mouse   216 VQSNSGPYFNARSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEVEFRQHLESKQHKSKV 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 15/59 (25%)
zf-met 104..126 CDD:289631 9/22 (41%)
zf-met 163..186 CDD:289631 2/23 (9%)
C2H2 Zn finger 164..186 CDD:275371 2/22 (9%)
UFD2 255..>338 CDD:227443 32/118 (27%)
ZnF_U1 304..336 CDD:197732 12/33 (36%)
Zmat3NP_033543.2 ZnF_U1 67..101 CDD:197732 12/37 (32%)
C2H2 Zn finger 72..94 CDD:275371 9/22 (41%)
ZnF_U1 145..178 CDD:197732 14/42 (33%)
C2H2 Zn finger 150..172 CDD:275371 9/22 (41%)
ZnF_U1 243..277 CDD:197732 12/33 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89561027
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131030
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46786
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5774
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.