DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1231 and Zmat1

DIOPT Version :9

Sequence 1:NP_612032.1 Gene:CG1231 / 38060 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_780655.2 Gene:Zmat1 / 215693 MGIID:2442284 Length:647 Species:Mus musculus


Alignment Length:266 Identity:58/266 - (21%)
Similarity:95/266 - (35%) Gaps:56/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 CQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEAPPVK--------RLAKQGPTGPN 160
            |:.|.|.:........|:||:.|.:::..:...:..:  .|.|..|        ::...|....|
Mouse    39 CKPCGVVLQHESERISHFESEIHAQNVKFFFQMHGEQ--SEVPGRKVNMHAGNSQVCSSGEVNRN 101

  Fly   161 AFHCELCNLDLTSSMHARQHYLGRKHKRV------EQGVAKPSGARHCDTSVGRYGIGSLFRKPE 219
            .| .:|.|:...|...|..||:|:.|...      |.....||   .|..           :..|
Mouse   102 NF-TDLHNMSFDSLAAAPSHYVGKSHSPTQNQSLEEHDQVSPS---TCSP-----------KMDE 151

  Fly   220 SLTKDSPTDVLISENSVIKSDDNER----TCHLCKIVVTSAAQMQAHLAGARHQ-------KNWR 273
            ..|..:|...|  ::.::|.....|    .||:|.|..||....::|:.|..||       ...:
Mouse   152 PNTTPAPPPFL--KSVIVKPPPAYRMRTYVCHICSITFTSLHMFRSHMQGTEHQIKESHVINQVK 214

  Fly   274 TSRQDQNHSEAPIPETEKL-DAAELALYRTPMGQYYCQPCNMM--MNHESTLQQHFIGKKHLKRV 335
            .|::.|...:|...:..|: .:.||    .|.|.:.....|.|  ..||   .:..:..:  .|.
Mouse   215 NSKKMQESCQAECGDDIKMKKSREL----EPKGHFREMEDNYMEAQAHE---YREMVDSR--PRH 270

  Fly   336 KNLSQT 341
            |.|.||
Mouse   271 KMLEQT 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 12/66 (18%)
zf-met 104..126 CDD:289631 6/21 (29%)
zf-met 163..186 CDD:289631 7/22 (32%)
C2H2 Zn finger 164..186 CDD:275371 7/21 (33%)
UFD2 255..>338 CDD:227443 19/92 (21%)
ZnF_U1 304..336 CDD:197732 6/33 (18%)
Zmat1NP_780655.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838289
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.