DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and ZNF385B

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001339738.1 Gene:ZNF385B HGNCID:26332 Length:532 Species:Homo sapiens

Alignment Length:295 Identity:68/296 (23%)
Similarity:115/296 (39%) Gaps:69/296 (23%)


  Fly    73 DSLKANGDLALFPGRDESYPEE---LNRLIG---------PLNCQLCKVQMTSRKRARDHYESKA 125
            ||..|.|   |||..:...|.:   :|...|         .::|.:|:::..|..:|..||:...
Human   180 DSSSAVG---LFPNFNTMDPVQKAVINHTFGVSIPPKKKQVISCNVCQLRFNSDSQAEAHYKGSK 241

  Fly   126 HDRHISAWLA-KNYTEVGLEAPPVKRLAKQGPTGPNAFHCELCNLDLTSSMHARQHYLGRKHKRV 189
            |.:.:.|..| ||..::    .|.|..||..|:      |.:..:...:|           .|..
Human   242 HAKKVKALDATKNKPKM----VPSKDSAKANPS------CSITPITGNNS-----------DKSE 285

  Fly   190 EQGVAKPSGARHCDTSVGRYGIGSLFRK-------------PESLTKDSPTDVLISENSVIKSDD 241
            ::|..|.|.:....:|..    ||...|             |...|..:|..|:.||....|   
Human   286 DKGKLKASSSSQPSSSES----GSFLLKSGTTPLPPGAATSPSKSTNGAPGTVVESEEEKAK--- 343

  Fly   242 NERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAPIPETEKLDAAELALYRTPMGQ 306
            ....|.|||:.|.|.:|::||..|::|:     :..:..:...||....: ..:.|.:.....|.
Human   344 KLLYCSLCKVAVNSLSQLEAHNTGSKHK-----TMVEARNGAGPIKSYPR-PGSRLKMQNGSKGS 402

  Fly   307 ------YYCQPCNMMMNHESTLQQHFIGKKHLKRV 335
                  ::|:.|::.:|.|..|:||...::|..||
Human   403 GLQNKTFHCEICDVHVNSEIQLKQHISSRRHKDRV 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 16/60 (27%)
zf-met 104..126 CDD:289631 6/22 (27%)
zf-met 163..186 CDD:289631 2/23 (9%)
C2H2 Zn finger 164..186 CDD:275371 2/22 (9%)
UFD2 255..>338 CDD:227443 20/88 (23%)
ZnF_U1 304..336 CDD:197732 11/39 (28%)
ZNF385BNP_001339738.1 ZnF_U1 50..80 CDD:197732
C2H2 Zn finger 220..242 CDD:275371 6/22 (27%)
zf-met 220..242 CDD:315537 6/22 (27%)
zf-met 346..370 CDD:315537 10/24 (42%)
C2H2 Zn finger 348..410 CDD:275371 15/68 (22%)
zf-met 409..433 CDD:315537 7/24 (29%)
C2H2 Zn finger 411..433 CDD:275371 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89549021
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.846 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.