DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and zmat4

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_002936484.2 Gene:zmat4 XenbaseID:XB-GENE-1219111 Length:342 Species:Xenopus tropicalis

Alignment Length:280 Identity:69/281 (25%)
Similarity:112/281 (40%) Gaps:64/281 (23%)


  Fly    80 DLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLE 144
            |.|||   .::|            |::|..|:.|..:...|||||.|...:..:...:..:.|  
 Frog    35 DRALF---TDTY------------CKICNAQLISESQRVAHYESKKHANKVRLYYMLHPEDGG-- 82

  Fly   145 APPVKRLAKQGPTGPNAFH--------CELCNLDLTSSMHARQHYLGRKH-KRVEQGVAK-PSGA 199
             ||.|:|.   |..|.:..        |.|||:..||::.|..||.|:.| |||:..:.: |:.|
 Frog    83 -PPSKKLR---PDDPESDETEVDKNKCCTLCNMFFTSAIVAESHYQGKTHAKRVKLVLGESPNTA 143

  Fly   200 RHCDTSVGRYGIGSLFRKPESLTKDSP--TDVLISENSVIKS----DDNERTCHLCKIVVTSAAQ 258
                             .|....:::|  |::...|...:.:    :::.:.|.||:....:...
 Frog   144 -----------------APAEPIQETPEHTEIPPQEEDTLWNLNIGNESRKFCDLCRAWFNNPLM 191

  Fly   259 MQAHLAGARHQKNWRTSRQDQNHSEAPIPETEKLDAAELALYRTPMGQYYCQPCNMMMNHESTLQ 323
            .|.|..|.:|:||...::..|...|.       ||:..|...|:   .|.|..|||::|......
 Frog   192 AQQHYEGKKHKKNAARAKLLQRLGET-------LDSEALEALRS---SYTCNICNMVLNSVEQYH 246

  Fly   324 QHFIGKKHLKRVKNLSQTEK 343
            .|..|.:|.....|:|...|
 Frog   247 AHLKGARHQNNANNISDGTK 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 17/59 (29%)
zf-met 104..126 CDD:289631 9/22 (41%)
zf-met 163..186 CDD:289631 10/31 (32%)
C2H2 Zn finger 164..186 CDD:275371 10/22 (45%)
UFD2 255..>338 CDD:227443 22/83 (27%)
ZnF_U1 304..336 CDD:197732 9/32 (28%)
zmat4XP_002936484.2 zf-met 43..66 CDD:289631 10/35 (29%)
C2H2 Zn finger 44..66 CDD:275371 9/22 (41%)
ZnF_U1 101..135 CDD:197732 14/34 (41%)
C2H2 Zn finger 106..128 CDD:275371 10/22 (45%)
ZnF_U1 175..207 CDD:197732 9/32 (28%)
C2H2 Zn finger 179..201 CDD:275371 6/22 (27%)
zf-met 231..254 CDD:289631 7/23 (30%)
C2H2 Zn finger 232..254 CDD:275371 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89388469
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.