DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and znf385a

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_004911980.1 Gene:znf385a XenbaseID:XB-GENE-987183 Length:407 Species:Xenopus tropicalis

Alignment Length:307 Identity:68/308 (22%)
Similarity:109/308 (35%) Gaps:102/308 (33%)


  Fly    81 LALFPGRDESYPEELNRLIGP-------------LNCQLCKVQMTSRKRARDHYESKAHDRHISA 132
            :.||||.....|.: ..:|.|             ::|.:|:::..|..:|..||:...|.|.:. 
 Frog    47 MGLFPGFSTMDPVQ-KAVISPSFGVPIIKTKRPVISCNVCQIRFNSESQAEAHYKGNRHARRVK- 109

  Fly   133 WLAKNYTEVGLEAPPVKRLAKQGPTGPNAFHCELCNLDLTSSM-----HARQHYLGRKHKRVEQG 192
                     |:|  ..|...|:|  |.::        |.|:.|     .|.:.....|.::|..|
 Frog   110 ---------GIE--NAKTRQKEG--GQDS--------DRTTPMISPTPSASESDSDSKDQQVADG 153

  Fly   193 VAKP--------------------------SGARHCDTSVGRYGIGSLFRKPESLTKDSPTDVLI 231
            |..|                          |.|...||.       ||   ..|.:..:.|....
 Frog   154 VDLPTADSPEAIATMLIHENITPTAPSFSSSEANRSDTK-------SL---SSSTSASNETSTST 208

  Fly   232 SENSVIKSDDNERT---CHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAPIPETEKLD 293
            |||    .||..:.   |.|||:.|.|.:|::||..|.:|:     :..:......||....:|.
 Frog   209 SEN----DDDRAKKLLYCALCKVSVNSLSQLEAHNKGTKHK-----TILEARSGLGPIKAYPRLG 264

  Fly   294 AAELA---------LYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKH 331
            ....|         ..||    ::|:.||:.:..|:.|:||...::|
 Frog   265 GLSTASNGPSDSSNQERT----FHCEICNVRVTSEAQLKQHISSRRH 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 14/59 (24%)
zf-met 104..126 CDD:289631 6/22 (27%)
zf-met 163..186 CDD:289631 5/28 (18%)
C2H2 Zn finger 164..186 CDD:275371 5/27 (19%)
UFD2 255..>338 CDD:227443 20/87 (23%)
ZnF_U1 304..336 CDD:197732 8/29 (28%)
znf385aXP_004911980.1 C2H2 Zn finger 82..104 CDD:275371 6/22 (27%)
zf-met 82..104 CDD:289631 6/22 (27%)
zf-met 221..244 CDD:289631 10/23 (43%)
C2H2 Zn finger 222..244 CDD:275371 10/22 (45%)
zf-met 284..307 CDD:289631 7/23 (30%)
C2H2 Zn finger 285..307 CDD:275371 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89409303
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.890

Return to query results.
Submit another query.