DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and znf385b

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_004917798.1 Gene:znf385b XenbaseID:XB-GENE-1219172 Length:479 Species:Xenopus tropicalis

Alignment Length:400 Identity:86/400 (22%)
Similarity:133/400 (33%) Gaps:145/400 (36%)


  Fly    55 DNGSIRTNMKRKAKCMEEDSLKANGDLALFPGRDE-SYPEELNRLIGPLNCQLCKVQMTSRKRAR 118
            :||.:.|.|  ..:|.||.        ..:..|.| .:..|..:::..| |::|.:|:.|..:|:
 Frog    13 ENGRMSTAM--FLRCFEEK--------VTWNDRTEHQFANENKKILFSL-CEVCNIQLNSAAQAQ 66

  Fly   119 DHYESKAH--------------------------------------------------------- 126
            .||..|:|                                                         
 Frog    67 IHYNGKSHLKRLKQLSNGKITPNSPSNSLLVSAGTGIFGSTCHTTTLPALVRTPSLMMQPSLDMK 131

  Fly   127 -------DRHISAWLAKNYTEV------------GLEAPPVKRLAKQGPTGPNAFHCELCNLDLT 172
                   |...:..|..|:..:            |:..||.|:         ....|.:|.|...
 Frog   132 PFVSFPMDSSPAVGLFPNFNTMDPVQKAVINHTFGVSMPPKKK---------QVISCNVCQLRFN 187

  Fly   173 SSMHARQHYLGRKH-----------KRVEQGVAKPSG-------ARH--------C-DTSVGRYG 210
            |...|..||.|.||           .:.:.|.:|.|.       |.|        | ..|.|...
 Frog   188 SDSQAEAHYKGSKHAKKLKVLEASKNKQKNGSSKDSAKAITSSTANHKSGEEEKVCGSVSHGIAE 252

  Fly   211 IGSLFRKPE-SLTKDSPTDVLISENSV--IKSDDNERT------CHLCKIVVTSAAQMQAHLAGA 266
            |.||..|.| :||...|..::.|.|..  |.|:..|..      |.|||:.|.|.:|:.||..|:
 Frog   253 IKSLIAKSEVALTAVIPATLVKSTNGTTNINSESEEEKAKKLLYCSLCKVAVNSLSQLDAHNTGS 317

  Fly   267 RHQKNWRTSRQDQNHSEAPIPETEKLDAAELALYRTPMGQ------YYCQPCNMMMNHESTLQQH 325
            :|    :|..:.:| ...||....: ..:.|.|.....|.      ::|:.|::.:|.|..|:||
 Frog   318 KH----KTMLEARN-GAGPIKSYPR-SGSRLKLQNGSKGSGLQNKTFHCEICDVHVNSEIQLKQH 376

  Fly   326 FIGKKHLKRV 335
            ...::|..||
 Frog   377 ISSRRHKDRV 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 16/135 (12%)
zf-met 104..126 CDD:289631 8/22 (36%)
zf-met 163..186 CDD:289631 9/23 (39%)
C2H2 Zn finger 164..186 CDD:275371 9/22 (41%)
UFD2 255..>338 CDD:227443 23/87 (26%)
ZnF_U1 304..336 CDD:197732 11/38 (29%)
znf385bXP_004917798.1 C2H2 Zn finger 52..74 CDD:275371 8/22 (36%)
zf-met 52..74 CDD:289631 8/22 (36%)
C2H2 Zn finger 179..201 CDD:275371 9/22 (41%)
zf-met 179..201 CDD:289631 9/22 (41%)
zf-met 296..319 CDD:289631 10/23 (43%)
C2H2 Zn finger 297..359 CDD:275371 18/68 (26%)
zf-met 359..382 CDD:289631 7/23 (30%)
C2H2 Zn finger 360..382 CDD:275371 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89548333
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.890

Return to query results.
Submit another query.