DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and zmat4a

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_003198682.2 Gene:zmat4a ZFINID:ZDB-GENE-081104-333 Length:283 Species:Danio rerio

Alignment Length:249 Identity:65/250 (26%)
Similarity:103/250 (41%) Gaps:52/250 (21%)


  Fly   104 CQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEAPPVKRL-----AKQGPTGPNAFH 163
            |::|..|:.|..:...||||:.|...:..:...:..:.|.   |.|:|     :::|....|.. 
Zfish    67 CKVCSAQLISESQRVAHYESRKHANKVRLYYMLHPVDGGC---PAKKLRTDDGSEEGDVDKNKC- 127

  Fly   164 CELCNLDLTSSMHARQHYLGRKH-KRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTKD--- 224
            |.|||:..||::.|:.||.|:.| ||::.                     .|..:|....|:   
Zfish   128 CTLCNMSFTSAVVAQSHYQGKIHAKRLKL---------------------LLGEQPAITAKEVPP 171

  Fly   225 SPTDVLISENSVIKS----DDNERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAP 285
            ||.....||.|.:.|    .|::|.|.||.....:....|.|..|.:|:||  .:|.|.      
Zfish   172 SPVKTASSEVSPVSSARQHRDSDRYCQLCNAWFNNPGMAQQHYDGKKHKKN--AARADL------ 228

  Fly   286 IPETEK-LDAAEL-ALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRVKN 337
            :.:..| ||..|: .|.|.    |.|..|::.:|..:....|..|.||...:|:
Zfish   229 LEQLGKTLDMGEMKGLKRC----YTCDVCSVTLNSVAQYHAHLQGSKHQNNLKS 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 15/64 (23%)
zf-met 104..126 CDD:289631 8/22 (36%)
zf-met 163..186 CDD:289631 10/23 (43%)
C2H2 Zn finger 164..186 CDD:275371 10/22 (45%)
UFD2 255..>338 CDD:227443 23/86 (27%)
ZnF_U1 304..336 CDD:197732 8/32 (25%)
zmat4aXP_003198682.2 C2H2 Zn finger 67..89 CDD:275371 8/22 (36%)
ZnF_U1 123..157 CDD:197732 14/56 (25%)
C2H2 Zn finger 128..150 CDD:275371 10/22 (45%)
ZnF_U1 192..225 CDD:197732 11/35 (31%)
C2H2 Zn finger 197..219 CDD:275371 6/22 (27%)
zf-met 248..272 CDD:315537 7/24 (29%)
C2H2 Zn finger 250..272 CDD:275371 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89517946
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.