DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1231 and zmat4a

DIOPT Version :9

Sequence 1:NP_612032.1 Gene:CG1231 / 38060 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_003198682.2 Gene:zmat4a / 100270739 ZFINID:ZDB-GENE-081104-333 Length:283 Species:Danio rerio


Alignment Length:249 Identity:65/249 - (26%)
Similarity:103/249 - (41%) Gaps:52/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 CQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEAPPVKRL-----AKQGPTGPNAFH 163
            |::|..|:.|..:...||||:.|...:..:...:..:.|.   |.|:|     :::|....|.. 
Zfish    67 CKVCSAQLISESQRVAHYESRKHANKVRLYYMLHPVDGGC---PAKKLRTDDGSEEGDVDKNKC- 127

  Fly   164 CELCNLDLTSSMHARQHYLGRKH-KRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTKD--- 224
            |.|||:..||::.|:.||.|:.| ||::.                     .|..:|....|:   
Zfish   128 CTLCNMSFTSAVVAQSHYQGKIHAKRLKL---------------------LLGEQPAITAKEVPP 171

  Fly   225 SPTDVLISENSVIKS----DDNERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAP 285
            ||.....||.|.:.|    .|::|.|.||.....:....|.|..|.:|:||  .:|.|.      
Zfish   172 SPVKTASSEVSPVSSARQHRDSDRYCQLCNAWFNNPGMAQQHYDGKKHKKN--AARADL------ 228

  Fly   286 IPETEK-LDAAEL-ALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRVKN 337
            :.:..| ||..|: .|.|.    |.|..|::.:|..:....|..|.||...:|:
Zfish   229 LEQLGKTLDMGEMKGLKRC----YTCDVCSVTLNSVAQYHAHLQGSKHQNNLKS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 15/63 (24%)
zf-met 104..126 CDD:289631 8/21 (38%)
zf-met 163..186 CDD:289631 10/22 (45%)
C2H2 Zn finger 164..186 CDD:275371 10/21 (48%)
UFD2 255..>338 CDD:227443 23/85 (27%)
ZnF_U1 304..336 CDD:197732 8/31 (26%)
zmat4aXP_003198682.2 C2H2 Zn finger 67..89 CDD:275371 8/21 (38%)
ZnF_U1 123..157 CDD:197732 14/55 (25%)
C2H2 Zn finger 128..150 CDD:275371 10/21 (48%)
ZnF_U1 192..225 CDD:197732 11/34 (32%)
C2H2 Zn finger 197..219 CDD:275371 6/21 (29%)
zf-met 248..272 CDD:315537 6/23 (26%)
C2H2 Zn finger 250..272 CDD:275371 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5301
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.