DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and znf385a

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_009295234.1 Gene:znf385a ZFINID:ZDB-GENE-090313-255 Length:423 Species:Danio rerio

Alignment Length:139 Identity:40/140 (29%)
Similarity:60/140 (43%) Gaps:14/140 (10%)


  Fly    71 EEDSLKANGDLALFPGRDESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAHDRHISAWLA 135
            |:....|.|..::.|...|:..::..:|   |.|.||||.:.|..:...|.:...|...:.|...
Zfish   207 EQAGTGAPGAPSVTPSNPETEEDKAKKL---LYCSLCKVAVNSLSQLEAHNKGTKHKTILEARSG 268

  Fly   136 ----KNYTEVGLEAPPVKRLAKQGPTGPN----AFHCELCNLDLTSSMHARQHYLGRKHKRVEQG 192
                |.|..:|   |...|....|.|.||    .||||:||:.:.|.:..:||...|:|:....|
Zfish   269 LGPIKAYPRLG---PKPSREQGGGATDPNTQERTFHCEICNVRVNSELQLKQHISSRRHRDGVAG 330

  Fly   193 VAKPSGARH 201
            ...|..:||
Zfish   331 KPNPLLSRH 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 19/67 (28%)
zf-met 104..126 CDD:289631 7/22 (32%)
zf-met 163..186 CDD:289631 9/23 (39%)
C2H2 Zn finger 164..186 CDD:275371 8/22 (36%)
UFD2 255..>338 CDD:227443
ZnF_U1 304..336 CDD:197732
znf385aXP_009295234.1 C2H2 Zn finger 78..100 CDD:275371
zf-met 78..100 CDD:289631
zf-met 236..259 CDD:289631 7/23 (30%)
C2H2 Zn finger 237..259 CDD:275371 7/22 (32%)
zf-met 301..324 CDD:289631 9/23 (39%)
C2H2 Zn finger 302..324 CDD:275371 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89404299
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.