DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and znf346

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_002936996.2 Gene:znf346 XenbaseID:XB-GENE-967544 Length:354 Species:Xenopus tropicalis

Alignment Length:289 Identity:61/290 (21%)
Similarity:116/290 (40%) Gaps:50/290 (17%)


  Fly    78 NGDLALFP-GRD--ESYPEELNRLIGPLNCQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYT 139
            :||....| |::  ::...|.:.:.....|::|...:.|..:...||:|:.|...:..:::.:..
 Frog     7 DGDTVELPVGKEAVDALIRENSHIFSDTQCKVCSAVLISESQKLAHYQSRKHANKVRRYMSIHQG 71

  Fly   140 EVGLEAPPVKRLAKQGPTGPNAFH-CELCNLDLTSSMHARQHYLGRKH-----KRVEQGVAKPSG 198
            |..:.|...|....:...|.:... |.:||:..:|.:.|..||.|:.|     .|.:.||.:   
 Frog    72 EEFVSAKKFKAAPAESSDGDDRSKCCPICNMTFSSPVVAESHYSGKTHIKNLRLREQGGVTE--- 133

  Fly   199 ARHCDTSVGRYGIGSLFRKPESLTKDSPTDVLISENSVIKSDDNERTCHLCKIVVTSAAQMQAHL 263
                         |.|.:..:.:...:||.....:|.:.:||.. :.|.||.....:....:.|.
 Frog   134 -------------GMLHQAKKLVVTRTPTIATKIDNRMDQSDPT-KFCKLCHATFNNPLMAEQHY 184

  Fly   264 AGARHQKNWRTSRQ------DQNHSEAPIPETEKLDAAELAL-YRTPM------GQ-YYCQPCNM 314
            ||.:|:|. .|..|      ...|:.|..|         :|: ..:|:      |: :.|..||:
 Frog   185 AGKKHKKQ-ETKTQLMTIYTSSGHTPAQAP---------IAINVNSPLPGSGSAGKGFSCDTCNI 239

  Fly   315 MMNHESTLQQHFIGKKHLKRVKNLSQTEK 343
            ::|.....|.|..|.||..::.:::...|
 Frog   240 VLNSIEQYQAHVSGAKHKNQLMSMTPLSK 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 11/59 (19%)
zf-met 104..126 CDD:289631 6/22 (27%)
zf-met 163..186 CDD:289631 8/24 (33%)
C2H2 Zn finger 164..186 CDD:275371 8/22 (36%)
UFD2 255..>338 CDD:227443 22/97 (23%)
ZnF_U1 304..336 CDD:197732 10/39 (26%)
znf346XP_002936996.2 ZnF_U1 36..65 CDD:197732 7/29 (24%)
C2H2 Zn finger 36..58 CDD:275371 6/22 (27%)
ZnF_U1 92..126 CDD:197732 9/34 (26%)
C2H2 Zn finger 97..119 CDD:275371 8/22 (36%)
ZnF_U1 165..195 CDD:197732 9/31 (29%)
C2H2 Zn finger 167..189 CDD:275371 6/22 (27%)
ZnF_U1 229..260 CDD:197732 10/31 (32%)
C2H2 Zn finger 234..256 CDD:275371 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89534390
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5051
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 1 1.000 T129308
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.