DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1231 and zmat4b

Sequence 1:NP_612032.1 Gene:CG1231 FlyBaseID:FBgn0035134 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_017213517.2 Gene:zmat4b ZFINID:ZDB-GENE-091118-68 Length:229 Species:Danio rerio

Alignment Length:241 Identity:59/242 (24%)
Similarity:106/242 (44%) Gaps:35/242 (14%)


  Fly   104 CQLCKVQMTSRKRARDHYESKAHDRHISAWLAKNYTEVGLEAPPVKRL-----AKQGPTGPNAFH 163
            |::|..|:.|..:...||||:.|...:..:...:..:.|.   |.|:|     :..|....|.. 
Zfish    16 CKVCSAQLISESQRVAHYESRKHANKVRLYYMLHPVDGGC---PAKKLRTDNGSADGDVDKNKC- 76

  Fly   164 CELCNLDLTSSMHARQHYLGRKH-KRVEQGVAKPSGARHCDTSVGRYGIGSLFRKPESLTKDSPT 227
            |.|||:..||::.|:.||.|:.| ||:...:.:|:.....:.:|          :|:.:..:...
Zfish    77 CTLCNMSFTSAVVAQSHYQGKIHAKRLRLLLGEPAAIMSKEVTV----------EPDHMMDEDWK 131

  Fly   228 DVLISENSVIKSDDNERTCHLCKIVVTSAAQMQAHLAGARHQKNWRTSRQDQNHSEAPIPETEKL 292
            |...|.|..:    ::|.|.:||....:....:.|..|.:|:||..     |.:..|.:.:|.: 
Zfish   132 DGSPSTNGKL----SQRYCQMCKAWFNNPGMARQHYNGKKHKKNGA-----QANLLAQLGKTLE- 186

  Fly   293 DAAEL-ALYRTPMGQYYCQPCNMMMNHESTLQQHFIGKKHLKRVKN 337
            |..|: .|.|:    :.|:.|::.:|..:....|..|.||...:||
Zfish   187 DGEEMNGLKRS----HTCEVCSVTLNSVAQYHAHLQGSKHQNNLKN 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1231NP_612032.1 C2H2 Zn finger 104..163 CDD:275371 15/64 (23%)
zf-met 104..126 CDD:289631 8/22 (36%)
zf-met 163..186 CDD:289631 10/23 (43%)
C2H2 Zn finger 164..186 CDD:275371 10/22 (45%)
UFD2 255..>338 CDD:227443 21/85 (25%)
ZnF_U1 304..336 CDD:197732 7/32 (22%)
zmat4bXP_017213517.2 ZnF_U1 15..45 CDD:197732 9/29 (31%)
C2H2 Zn finger 16..38 CDD:275371 8/22 (36%)
C2H2 Zn finger 77..99 CDD:275371 10/22 (45%)
zf-met 77..99 CDD:315537 10/22 (45%)
DUF3449 <111..>199 CDD:331240 21/112 (19%)
ZnF_U1 142..171 CDD:197732 8/29 (28%)
C2H2 Zn finger 146..168 CDD:275371 5/22 (23%)
zf-met 199..222 CDD:315537 6/23 (26%)
C2H2 Zn finger 200..222 CDD:275371 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89517961
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5217
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565630at2759
OrthoFinder 1 1.000 FOG0001233
OrthoInspector 1 1.000 T128793
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.