DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl10 and mth

DIOPT Version :8

Sequence 1:NP_788446.2 Gene:mthl10 / 38057 FlyBaseID:FBgn0035132 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_728521.1 Gene:mth / 38058 FlyBaseID:FBgn0023000 Length:522 Species:Drosophila melanogaster

Alignment Length:523 Identity:179/524 (34%)
Similarity:281/524 (54%) Gaps:55/524 (10%)


  Fly    56 CNFYDTVNLTGHRLFPNGSYDYYGTIVPAELVGTYDYIHSSLTERIEVREHVRGCVCKFKSCLNI 120
            |:::|||:::..:...||||.:.|.:|||.|.|.||:.......:.:|..|:||||||.|.|:..
  Fly    29 CDYFDTVDISAAQKLQNGSYLFEGLLVPAILTGEYDFRILPDDSKQKVARHIRGCVCKLKPCVRF 93

  Fly   121 CCPWRQVFNSEVDGCIIDHSDNRTWPDPPMLNIT----------FRNESTILVNMFTQFAIQSFR 175
            |||...:.::.|  |..:.||.......|.||:|          |:||      :..|:.:.  .
  Fly    94 CCPHDHIMDNGV--CYDNMSDEELAELDPFLNVTLDDGSVSRRHFKNE------LIVQWDLP--M 148

  Fly   176 PCPKMFSLQPETNNWDDYLLFENGSMLRVDDKLLIRKNEFCMVP-TYVNESDMFYTIHPANCDMQ 239
            ||..||.|. .....|.|.|||||:..|..|::.:||.|:|:.. |:.:.:.....|.|.||.:.
  Fly   149 PCDGMFYLD-NREEQDKYTLFENGTFFRHFDRVTLRKREYCLQHLTFADGNATSIRIAPHNCLIV 212

  Fly   240 DDHSTVKIINSYAMMFSIPFMMLTIAVYLLIPELRNQHGKSLVCYLIGLSVGYSSLCYVQLYQVD 304
            ...:...::    |:.|:..|:|||||||.:.:|:|.|||..:||::.|.:||..| .:.|:|:.
  Fly   213 PSITGQTVV----MISSLICMVLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFL-LLDLWQIS 272

  Fly   305 ATGVTCKVFGYTAYFFFMGAYMWLSVISFDLWHNFRG-TRGINRFQEKKRFLFYSLYSWGIALVF 368
            .:  .||..|:..|||.|.|:.||||||..||:.||| :...|||..:.|||.|:.|:||:|:|.
  Fly   273 IS--FCKPAGFLGYFFVMAAFFWLSVISLHLWNTFRGSSHKANRFLFEHRFLAYNTYAWGMAVVL 335

  Fly   369 LAFTYCAQQLTNLPANLKPGIGDGVYCWLDMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGV 433
            ...|..|..:.. ..:..|.:|...:||:....|:||:|||||::.::..|..|||:||.:|.||
  Fly   336 TGITVLADNIVE-NQDWNPRVGHEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTAKRILGV 399

  Fly   434 QREMARIIASENSTKNLRTEKDKRFYRAWSNYRFGLFLRLFLIMGITWLTELISYFVGSDKGWSK 498
            ::::......:...:.|.::|        ..|.|  |||||:|||::|..|:.|||..|::.|:.
  Fly   400 KKDIQNFAHRQERKQKLNSDK--------QTYTF--FLRLFIIMGLSWSLEIGSYFSQSNQTWAN 454

  Fly   499 LFYISDLANAMQGFLIFMLFVMKKKVKHLITNRCSSVRDGSNQRQSQYSTKTTSSSVANLSLHEK 563
            :|.::|..|..||.:||:|||:|:....|:              |.:...|:|.|.::|.|:..:
  Fly   455 VFLVADYLNWSQGIIIFILFVLKRSTWRLL--------------QERNHPKSTRSVISNRSMASR 505

  Fly   564 PSV 566
            .:|
  Fly   506 ITV 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mthl10NP_788446.2 Methuselah_N 56..236 CDD:284145 63/191 (33%)
7tm_4 244..514 CDD:304433 101/271 (37%)
mthNP_728521.1 Methuselah_N 29..209 CDD:284145 63/191 (33%)
7tm_4 219..416 CDD:304433 77/205 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5058
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR47154
RoundUp 00.000 Not matched by this tool.
33.160

Return to query results.
Submit another query.