DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl10 and Dh44-R1

DIOPT Version :8

Sequence 1:NP_788446.2 Gene:mthl10 / 38057 FlyBaseID:FBgn0035132 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster

Alignment Length:593 Identity:119/594 (20%)
Similarity:198/594 (33%) Gaps:225/594 (38%)


  Fly    57 NFYDTVNLTG-------HRLFPNGSYDYYGTIVPAELVGTYDYIHSSLTERIEVREHVRG----- 109
            |..|:||.:|       |.|                     |.|..|:..:..|:||:..     
  Fly     5 NHIDSVNASGSDPLLDLHNL---------------------DGIGESVELQCLVQEHIEASTYGN 48

  Fly   110 ----CVCKFKSCLNICCPWRQVFN---------SEVDGCIIDHSDNRTWPDPPMLNITFRNESTI 161
                |:.:|.|   |.| |.:...         .|:.|...|.|.|.|                 
  Fly    49 DSGHCLTQFDS---ILC-WPRTARGTLAVLQCMDELQGIHYDSSKNAT----------------- 92

  Fly   162 LVNMFTQFAIQSFRPCPKMFSLQPETNNWDDYLLFENGSMLRVDDKLLIRKNEFCMV---PT--- 220
                         |.|       .....|:.|..::..:.|...:.:    .||.::   ||   
  Fly    93 -------------RFC-------HANGTWEKYTNYDACAHLPAPESV----PEFEVIVELPTIIY 133

  Fly   221 YVNESDMFYTIHPANCDMQDDHSTVKIINSYAMMFSIPFMMLTIAVYLLIPELR----NQHGKSL 281
            |:.     ||:                        |:..:.|.:.|:....|||    ..|....
  Fly   134 YIG-----YTL------------------------SLVSLSLALIVFAYFKELRCLRNTIHANLF 169

  Fly   282 VCYLIGLSVGYSSLCYVQLYQVD---ATGV-TCKVFGYTAYFFFMGAYMWLSVISFDLW----HN 338
            ..|::      |:|.::.|..|.   .:|| :|.......:||.:..:.|:.|....|:    ..
  Fly   170 FTYIM------SALFWILLLSVQISIRSGVGSCIALITLFHFFTLTNFFWMLVEGLYLYMLVVKT 228

  Fly   339 FRGTRGINRFQEKKRFLFYSLYSWGIALVFLAFTYCAQQLT---NLPANLKPGIGDGVYC-WLDM 399
            |.|        :..||..|:...||...:|:.....|:.||   :.|...:      :.| |:..
  Fly   229 FSG--------DNLRFNIYASIGWGGPALFVVTWAVAKSLTVTYSTPEKYE------INCPWMQE 279

  Fly   400 S--NWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENSTKNLRTEKDKRFYRAW 462
            :  :|    .:.||:.|:::.| :.|::         |.|..:|....|...:.|.:.::..:| 
  Fly   280 THVDW----IYQGPVCAVLIIN-LTFLL---------RIMWVLITKLRSANTVETRQYRKAAKA- 329

  Fly   463 SNYRFGLFLRLFLIMGITWLTELI----SYFVG-----------SDKGWS-KLFYI---SDLANA 508
                   .|.|..:.|||:|..|.    |..:|           |.:|:| .|||.   |::.||
  Fly   330 -------LLVLIPLFGITYLVVLAGPSESGLMGHMFAVLRAVLLSTQGFSVSLFYCFLNSEVRNA 387

  Fly   509 MQGFL-------IFML-----FVMKKKVKHLITNRCSSVRD-----GSNQRQSQYSTKTTSSSV- 555
            ::..:       ...|     :..|...|...:.|..|:|.     |..:|:|..|:.||::.| 
  Fly   388 LRHHISTWRDTRTIQLNQNRRYTTKSFSKGGGSPRAESMRPLTSYYGRGKRESCVSSATTTTLVG 452

  Fly   556 --ANLSLH 561
              |.||||
  Fly   453 QHAPLSLH 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mthl10NP_788446.2 Methuselah_N 56..236 CDD:284145 37/210 (18%)
7tm_4 244..514 CDD:304433 64/314 (20%)
Dh44-R1NP_610960.1 HRM 52..112 CDD:280888 16/101 (16%)
7tm_2 127..373 CDD:278432 63/317 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C100403668
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.