DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac3 and DBP10

DIOPT Version :8

Sequence 1:NP_001246531.1 Gene:Atac3 / 38055 FlyBaseID:FBgn0052343 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_010253.2 Gene:DBP10 / 851530 SGDID:S000002189 Length:995 Species:Saccharomyces cerevisiae

Alignment Length:493 Identity:101/494 (20%)
Similarity:157/494 (32%) Gaps:149/494 (30%)


  Fly    53 DLGKQLLQCARDSDVAGVKAALAH---------GAP---------FASDWLGMSALHFAAMNNQL 99
            ||.|.|:....|..:|...|..|.         .:|         .:|.|...:|  |...|.:.
Yeast   608 DLYKNLMSSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIISSGWDAQNA--FFGKNEEK 670

  Fly   100 EICEIL--LQGGINMDGKTKVDRTPLHLACYYGHERIVSLLLALKCSVNSRDML---RMTPLHWA 159
            |..:.|  ||...|.:...:..|.|......:...|...|....:.:...|::|   ||..|..:
Yeast   671 EKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHS 735

  Fly   160 VEKKHKGIVRLLLKCQADVTLVSKFGKTPIGLAVYTEQADVLAELEAARQAQASKKLHEESEQQA 224
            :|               |..|....|:|.     ||...|.|.|.|.|.|      |.|..|.:.
Yeast   736 IE---------------DEILKGDDGETG-----YTVSEDALKEFEDADQ------LLEAQENEN 774

  Fly   225 HKTKKETNEAVSSIMDEPEVIK------TVDDKEMSVEERMDVLENMRGHANVLRNTALYILKTH 283
            .|.||.     .|..|....:.      .:.||::.:         ..|.||.....| |.|.:.
Yeast   775 KKKKKP-----KSFKDPTFFLSHYAPAGDIQDKQLQI---------TNGFANDAAQAA-YDLNSD 824

  Fly   284 EIADMVQDND-------DEDSKEMLNTALQNGRQLVLSEGGRMLLHETKSGISGKQSTNGNARPS 341
               |.||.:.       |:..|:.:||...:.::.::.|.|:.:....:||.....|...|.:| 
Yeast   825 ---DKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKP- 885

  Fly   342 VAALRTNVNNSHPKIRMNVLKQKDLPSPAGVAKNKNIRIISLTDFKKLYGSDSTAKSLQKIPASL 406
                 ..|.:....|..|:|:.   ||....|..:.:|                           
Yeast   886 -----LKVGSRETSIPSNLLED---PSQGPAANGRTVR--------------------------- 915

  Fly   407 ASSGMVRHLPDGTKLVNMRQLQARQLKLPSLQRPQDLTALEESHSQNEAAVPSPLPSGHPASG-- 469
               |..:|          :|::|.  |:|...|        :::...:..|...|.||....|  
Yeast   916 ---GKFKH----------KQMKAP--KMPDKHR--------DNYYSQKKKVEKALQSGISVKGYN 957

  Fly   470 --SSLRGQVGTVQTIQLRPSLSAGSGQGAVNNGAAPGK 505
              ..||.::.:  |.|:|........:.|.|  |.|.|
Yeast   958 NAPGLRSELKS--TEQIRKDRIIAEKKRAKN--ARPSK 991

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atac3NP_001246531.1 Ank_4 58..106 CDD:290365 13/68 (19%)
ANK repeat 58..83 CDD:293786 7/43 (16%)
ANK 81..204 CDD:238125 29/128 (23%)
ANK repeat 88..116 CDD:293786 8/30 (27%)
Ank_2 90..181 CDD:289560 19/96 (20%)
ANK repeat 118..149 CDD:293786 5/31 (16%)
ANK repeat 151..181 CDD:293786 7/33 (21%)
ANK repeat 184..211 CDD:293786 10/27 (37%)
DBP10NP_010253.2 SrmB 110..649 CDD:223587 9/41 (22%)
DEADc 139..341 CDD:238167
HELICc 411..535 CDD:238034
DBP10CT 820..880 CDD:285373 13/63 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0337
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.