DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac3 and gabpb2b

DIOPT Version :8

Sequence 1:NP_001246531.1 Gene:Atac3 / 38055 FlyBaseID:FBgn0052343 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001070620.1 Gene:gabpb2b / 561215 ZFINID:ZDB-GENE-050208-136 Length:418 Species:Danio rerio

Alignment Length:443 Identity:131/444 (30%)
Similarity:197/444 (44%) Gaps:91/444 (20%)


  Fly    52 VDLGKQLLQCARDSDVAGVKAALAHGAPFASDWLGMSALHFAAMNNQLEICEILLQGGINMDGKT 116
            |||||:||:.||......|::.:|:||||.:||||.|.||.||........|:||:.|::.|.:|
Zfish     4 VDLGKRLLEAARKGQDDEVRSLMANGAPFTTDWLGTSPLHLAAQYGHYSTAEVLLRAGVSRDART 68

  Fly   117 KVDRTPLHLACYYGHERIVSLLLALKCSVNSRDMLRMTPLHWAVEKKHKGIVRLLLKCQADVTLV 181
            ||||||||:|...||..||.||:.....:|::|||:||.||||.|..|:|:|.||:|..||...:
Zfish    69 KVDRTPLHMAAAEGHSSIVELLVKSGADINAKDMLKMTALHWATEHGHRGVVELLVKYGADTHAL 133

  Fly   182 SKFGKTPIGLAVYTEQADVLAELEAARQAQASKKLHEESEQQAHKTKKETNEAVSS---IMDEPE 243
            |||.|||..::|.....|::..|:...|.|.:  ::.|     ......|:.|.||   |:....
Zfish   134 SKFDKTPFNISVDRGNTDLMLLLQEGMQNQVN--MNPE-----RTILSSTSPATSSPQFIISSSG 191

  Fly   244 VIKTVDDKEMSVEERMDVLENMRGHANVLRNTALYILKTHEIADMVQDNDDEDSKEMLNTALQNG 308
            |:...|          .||.|.:.      |||        .::.|...|..||      |:|: 
Zfish   192 VVNLSD----------IVLSNAKS------NTA--------ASESVIAADSVDS------AIQH- 225

  Fly   309 RQLVLSEGGRMLLHETKSGISGKQSTNGNARPSVAALRTNVNNSHPKIRMNVLKQKDLPSPAG-V 372
              ||..:|.|::...|        ...||.:|.        |..| |..:.:..|:.:..||| :
Zfish   226 --LVGEDGQRVITIVT--------DQQGNLQPG--------NLGH-KFFVTMQGQQMVAVPAGQI 271

  Fly   373 A--------------KNKNIRIISLTDFKKLYGSDSTAKSLQKIPASLASSGMVRHLPDGTKLVN 423
            |              |.|....::.||.|.....:..::.:.:.....|:    |...:..:.:.
Zfish   272 AEEIVTEEPKPVPSRKRKFESTMNHTDVKHKEPDEKDSREVLEQQLKEAN----RKAQEYRQQLM 332

  Fly   424 MRQLQARQ--LKLPSL-------QRPQDLTALEESHSQNEAAVPSP---LPSG 464
            .::.:|.|  |||.::       ..||:...|:|...:.|......   ||.|
Zfish   333 RKEQEAEQYRLKLEAIANGQTNGTEPQEEVVLQEEEEEEEVVGEEEVVMLPEG 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atac3NP_001246531.1 Ank_4 58..106 CDD:290365 21/48 (44%)
ANK repeat 58..83 CDD:293786 10/25 (40%)
ANK 81..204 CDD:238125 57/123 (46%)
ANK repeat 88..116 CDD:293786 10/28 (36%)
Ank_2 90..181 CDD:289560 44/91 (48%)
ANK repeat 118..149 CDD:293786 15/31 (48%)
ANK repeat 151..181 CDD:293786 16/30 (53%)
ANK repeat 184..211 CDD:293786 8/27 (30%)
gabpb2bNP_001070620.1 Ank_4 10..58 CDD:290365 21/48 (44%)
ANK repeat 10..35 CDD:293786 10/25 (40%)
ANK 34..156 CDD:238125 57/122 (47%)
ANK repeat 38..68 CDD:293786 11/30 (37%)
Ank_2 42..132 CDD:289560 44/90 (49%)
ANK repeat 70..101 CDD:293786 15/31 (48%)
ANK repeat 103..132 CDD:293786 16/29 (55%)
GrpE 297..>346 CDD:295646 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214944174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1514706at2759
OrthoFinder 1 1.000 FOG0002087
OrthoInspector 1 1.000 T596118
orthoMCL 1 0.900 OOG5_134730
Panther 1 1.100 O PTHR24193
Phylome 1 0.910 0.769 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.