DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic61B and wdr78

DIOPT Version :8

Sequence 1:NP_728477.1 Gene:Dic61B / 38020 FlyBaseID:FBgn0263988 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001018595.1 Gene:wdr78 / 553797 ZFINID:ZDB-GENE-050522-322 Length:778 Species:Danio rerio

Alignment Length:711 Identity:169/712 (24%)
Similarity:289/712 (41%) Gaps:115/712 (16%)


  Fly   106 MTNFTTMVAKST--------TRSRTRSSVRAGIGGNKQSIDDLMNGILYETINWEPYSTVEALEE 162
            ||.|.::..::|        |||...|:..:.|....:|:.|....:|.:.......|.:::..|
Zfish   110 MTEFPSIAFQTTNASLTGPFTRSFFGSASASRISQTAESVTDETKDLLVKQDLSNSISDIQSHRE 174

  Fly   163 AYEPKPYTKSFLKITLRKSDFFEIHSQTQT------TVAKGSPEGDDAER-DNRNYEYLTIGKGK 220
              |||..    |:..:..|......|:|:|      .....|.|.:|||. ..||..|..:.|  
Zfish   175 --EPKEQ----LRENILDSTANCYLSETETIWLLDIPAVSVSLESEDAEAVKERNNAYTELCK-- 231

  Fly   221 IRRRSDNDAQTDTLLFT------TRAVNTILITKATVSSYVSNFEMYDTLNNITKEFATATMSSV 279
              .|..||...:..:.|      |:.|....||....:...:.::|||:.|||:...|...:||.
Zfish   232 --NRQGNDKYVERSMQTFSDAPKTKEVQCDSITMVDKAVMCTVWDMYDSFNNISDVSANTVVSSE 294

  Fly   280 K------------------------DLTSALAQTEDADTFEDDEAVAEKDKVSSQIERLFRSPEF 320
            :                        .:.|.::....:.|..:..|..........::.:.:|.:.
Zfish   295 RHEATIPESSPEGHLVHPKRSNQSLSVVSTVSTVSGSSTHIEKMACVLPLDEEPDLQLILQSDKL 359

  Fly   321 RNAIMYMGRTLSSNTNEAGLRRFRNFDQVERWNAEAEYVYSMNLLFRLVPEPSKDERKAVSDIDF 385
            :..:..|.|.:.:|..:..|..:|....:|          ..:.:..::.|.|..|:...|...|
Zfish   360 KQDLALMERVVLANVFQPKLAAYRQLPIIE----------DPDCVQMVMEEESWTEQSKNSHCPF 414

  Fly   386 ------------------C----RSNGDILAVAYGLYSFSSQHVPTSGSVFLWSIKNPGEPERAY 428
                              |    :.|.|:|||.||...|.:   |.||.|..||:|||..|:|.:
Zfish   415 LERLWDFSCELTMGRNVTCMVWNKKNPDLLAVGYGQVEFKN---PNSGLVCCWSLKNPTWPDRVF 476

  Fly   429 YYDVPVTAINFSPFLPSLLAIGLYDGSVEVRDVSSLQDTPVAVSQRSTSPGSSPVVAIRWIKQVS 493
            |.:..|||::||....:.||:|:|||::.:.:|.:.:.||:..|....:..:|||..:.||    
Zfish   477 YCESGVTALDFSASNANQLAVGMYDGTIAIYNVQTSEQTPITDSSDCANLHTSPVWQLTWI---- 537

  Fly   494 DDDHETDI-----DPFLSLSQDGSVTRFRIIKSPFLLGFTQMILERVEGHPEGIFVHPSSRIPCE 553
              |||..:     :..:|:|.||.::::...||...:...::.:..::...     |.||..|  
Zfish   538 --DHEDGLAADKGEILVSVSSDGRISKWIHYKSMECVDLMKLKIHDLQWKQ-----HISSLTP-- 593

  Fly   554 SNRHPQGLSITTHPLHKDIYYVLTDEGCIHKCSINYQHQYLEVLRCHDGGVTVMEFSPWSPKLFL 618
                  |:....||....||.|.|:||.|||||.:|..|||:..:.|...|..:.:||:...:||
Zfish   594 ------GMCFDFHPNDSKIYLVGTEEGHIHKCSSSYNEQYLDSYKAHKRPVYKVTWSPFCSDVFL 652

  Fly   619 TCGNDWFVRIWVDGITRPLLELLDEMTPVHWAKWSPTHSTIIVTVNRETANVWDFRRNLLRPMSK 683
            :|.:||.:::|...:..|::........|....|||..:|:...|:.....:||.|.:.|.|...
Zfish   653 SCSSDWTIQLWRQDLQIPVMGFTSGQRVVFDIMWSPHCATVFGAVSEGKVEIWDLRVSSLDPTLV 717

  Fly   684 HKMDSSFN-TVARFSHCGRTLVIGNERGNTLFNALNDMPFSPHFQYDELEKAIFKAIGNDH 743
            :......| |...||.....:::|:..|......|.::......|.:.||..|...:.:.|
Zfish   718 NWTSPGVNPTALLFSPETDCVLVGDSEGQVTVYKLKNITAGGGSQGETLEDVIQSTLSSQH 778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dic61BNP_728477.1 WD40 358..730 CDD:225201 107/400 (27%)
WD40 repeat 381..429 CDD:293791 22/70 (31%)
WD40 433..711 CDD:295369 79/284 (28%)
WD40 repeat 434..473 CDD:293791 15/39 (38%)
WD40 repeat 552..599 CDD:293791 18/47 (38%)
WD40 repeat 604..637 CDD:293791 10/33 (30%)
WD40 repeat 645..682 CDD:293791 11/37 (30%)
WD40 repeat 691..727 CDD:293791 7/37 (19%)
wdr78NP_001018595.1 WD40 repeat 431..473 CDD:293791 19/45 (42%)
WD40 <459..754 CDD:225201 90/314 (29%)
WD40 479..751 CDD:295369 79/291 (27%)
WD40 repeat 483..526 CDD:293791 14/43 (33%)
WD40 repeat 531..576 CDD:293791 12/51 (24%)
WD40 repeat 589..624 CDD:293791 18/43 (42%)
WD40 repeat 638..675 CDD:293791 10/37 (27%)
WD40 repeat 681..707 CDD:293791 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C305106549
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H11702
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D310818at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130590
Panther 1 1.100 O PTHR12442
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.