DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic61B and CG1571

DIOPT Version :8

Sequence 1:NP_728477.1 Gene:Dic61B / 38020 FlyBaseID:FBgn0263988 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_572435.1 Gene:CG1571 / 31725 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster

Alignment Length:523 Identity:105/524 (20%)
Similarity:181/524 (35%) Gaps:173/524 (33%)


  Fly   295 FEDDEAVAEKDKVSSQIERLFRSPEFRNAIMYMGRTLSS-----NTNEAGLRRFRNF-------- 346
            |.|:|......|      ::.|...:...::.|.||..|     ||    |..::||        
  Fly    87 FNDEEQTQRHRK------KVEREDSWGEQVLSMIRTTMSVAEQNNT----LNIYQNFFADLPPEL 141

  Fly   347 --DQVERWNAEAEYVY-------------------SMNLLFRLVPEPSKDER-KAVSDIDFCRSN 389
              |...|:.|....|:                   |...:.:.....:|.|| :.|:|..|..:|
  Fly   142 GHDIKMRFRARVANVFHDLWLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPFGGTN 206

  Fly   390 GDILAVAYGLYSFSSQHVPTSGSVFLWSIKNPGEPERAYYYDVPVTAINFSP----------FLP 444
            |                      .::|.:|||.:|...|.....|:.....|          .|.
  Fly   207 G----------------------FYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLG 249

  Fly   445 SLLAIGLYDGSVEVRDVSSLQDTPVAVSQRSTSPGSSPVVAIRWIKQVSDDDHETDIDPFLSLSQ 509
            .:...|.:.|.:.:|      :.|:.||.|.|:.      |:.|:...|:.:       |.|.|.
  Fly   250 QVCLWGTFKGGLPIR------NCPLEVSHRETTS------ALCWVHSKSNTE-------FYSGSL 295

  Fly   510 DGSVTRF--RIIKSPFLLGFTQMILERVEGHPEGIFVHPSSRIPCESNRHPQGLSITTHPLHKDI 572
            |||:..:  |.:|.|    ..:::||     ||     |..|   :|.....|:::........:
  Fly   296 DGSIKYWDTRDLKMP----MQELLLE-----PE-----PQER---QSRMDSHGVTVLEFEYTIPV 343

  Fly   573 YYVL-TDEGCIHKCSINYQHQY---------LEVLRCH----DGGVTVMEFSPWSPKLFLTCGND 623
            .::: :|.|          |.:         :|.|..|    .|.|..:..:|:..|.||..| |
  Fly   344 RFIIGSDMG----------HVFVGNRKGMTPMETLLAHYQLFVGPVRSINRNPFFVKNFLVTG-D 397

  Fly   624 WFVRIWVDGITRPLLELLDEMTPVHWAK--------WSPTHSTIIVT--VNRETANVWDFRRNLL 678
            |..|||.:       |:.|..:.:::.|        ||....::.||  :| ...:.||...:..
  Fly   398 WRARIWSE-------EVKDSPSTMYFRKNAQILCGAWSTGRCSLFVTGDIN-GVVDFWDLLLHHR 454

  Fly   679 RPMSKHKMDSSFNTVARFSHCGRTLVIGNERGNTLFNALNDMPFSPHFQYDELEKAIFKAIGNDH 743
            :|:.......:...:. |...|..|.||.:.|:|            |..  .|::::.:|.|.:.
  Fly   455 KPIRSVDFKVAIADLV-FRPEGDLLAIGLKNGDT------------HIM--TLDESMRQATGKEK 504

  Fly   744 ELL 746
            .|:
  Fly   505 ALM 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dic61BNP_728477.1 WD40 358..730 CDD:225201 84/428 (20%)
WD40 repeat 381..429 CDD:293791 10/48 (21%)
WD40 433..711 CDD:295369 66/314 (21%)
WD40 repeat 434..473 CDD:293791 9/49 (18%)
WD40 repeat 552..599 CDD:293791 7/57 (12%)
WD40 repeat 604..637 CDD:293791 11/33 (33%)
WD40 repeat 645..682 CDD:293791 9/47 (19%)
WD40 repeat 691..727 CDD:293791 8/36 (22%)
CG1571NP_572435.1 WD40 210..462 CDD:295369 66/307 (21%)
WD40 211..>488 CDD:225201 73/345 (21%)
WD40 repeat 229..269 CDD:293791 7/46 (15%)
WD40 repeat 277..325 CDD:293791 18/78 (23%)
WD40 repeat 332..369 CDD:293791 5/47 (11%)
WD40 repeat 379..415 CDD:293791 13/44 (30%)
WD40 repeat 422..447 CDD:293791 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60888887
eggNOG 1 0.900 E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.