DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lov and BtbVII

Sequence 1:NP_611994.3 Gene:lov FlyBaseID:FBgn0266129 Length:1143 Species:Drosophila melanogaster
Sequence 2:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster

Alignment Length:1146 Identity:228/1147 (20%)
Similarity:359/1147 (31%) Gaps:466/1147 (41%)


  Fly   115 YSLRWNNHQNHILRAFDALLKTKTLVDVTLVCAETSIRAHKMVLSACSPFFQRVFAETPCKHPVI 179
            :.|||||||.:.:....:||...|||||||......::|||:||||||.:||.:|...||:||::
  Fly     6 FCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQHPIV 70

  Fly   180 VLKDFRGWVVQAIVDFMYRGEISVPQQRLQTLIQAGESLQVRGLVESSVPEHTPTPAASPDDFGM 244
            :|||.:...::.:|||||.||::|.|::|..:::..|.|:::||.|      .||     |...:
  Fly    71 ILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAE------MPT-----DPANL 124

  Fly   245 LDTSMLSSTFEDECPTMVRPSKGGKLLMPSARLFGNASSAIAALGLRRKREQESDRDLESDQELG 309
            ..:...|||...|   ||    ||..:...|   ||::.::.|                      
  Fly   125 TKSDSKSSTDGTE---MV----GGAGVGTGA---GNSAGSLGA---------------------- 157

  Fly   310 GSSPMPRRKQARPRRRSGDVPHDFTLNKTDAESLQTVIKHELLERAERDQEEAPDQDNSQGEAEK 374
                           .||....|...:.::|:..|           ::.|::|..|...|...  
  Fly   158 ---------------GSGSSVGDSLWSSSEAQQFQ-----------QQQQQQAQQQAQQQHHH-- 194

  Fly   375 ISSSPAKTLVERAKEQKSMKEEGSDQPRSLNENHHQLELDDEDDDDQDHEEEEEQDIEELIHTTN 439
                      .:.::|...:::.:.|.:...::||             |..:::|.         
  Fly   195 ----------HQQQQQLQQQQQQAQQQQQQQQHHH-------------HHHQQQQS--------- 227

  Fly   440 ELRRQAAAAAANAAAMSPNPSPCLSDGPEDLCTTKKGKELISGPSSSADCESNNNNSSKLQDNNQ 504
               .||.||..:...|...||| ||.|.......|:.::       |::..|.:.|:::.|.|: 
  Fly   228 ---GQAQAAQTHHHQMRRTPSP-LSAGTSPATRRKRLRK-------SSNNGSGDRNNAEEQHNS- 280

  Fly   505 RIMLSLKDIRQLNANPNPTAIHTPTSCSGGNNGLLTFPPPGLRPPGLPDSPPCHMEALEAQMHAA 569
                      .|:|.            ||..|..|:.                      |||:..
  Fly   281 ----------SLDAG------------SGAGNAGLSL----------------------AQMNQM 301

  Fly   570 AAAAVAAAGSGEHPFHHMEHQMEMSLAAAAAAAAMHQREPRDPRDGRDHNAFASNLLGPMGMPP- 633
            ...  |..|...|..|..:     .|..:|:|....|.:..|..||..|.        .|.:.| 
  Fly   302 TFG--AGGGLAGHSLHAAK-----LLKESASAELEQQPQDSDLDDGHGHL--------HMQIKPE 351

  Fly   634 --FGGHNGGHP----GNSGPGNGCPGQAAHERLEESMNRLSKELGKEFGKEFGKEFGKEFGPASP 692
              .||.|...|    |.:.|       :.|:                             .|.|.
  Fly   352 VDIGGVNQTMPLDISGGTTP-------SEHD-----------------------------APNSQ 380

  Fly   693 MSLQGPFNAPDGPPHPPSPLPFPGMSSAMTLTPPHMFGLDSPLGLFPPGIDPGKLYNPLMEMSDP 757
            .|...|  :|...||||.|                                              
  Fly   381 SSHSEP--SPAHAPHPPHP---------------------------------------------- 397

  Fly   758 RDMPGGPPPFLKKKMPRPKGQHSAPRGGPPRSWTNTELTEALQHVWNKKMTTSQASRIFGIPYNS 822
                             |.|..|:..||                       :....|.|.|    
  Fly   398 -----------------PLGAASSSSGG-----------------------SGSFERSFSI---- 418

  Fly   823 LLMYVRGKYGKSLKLEQLRKDCISGPPIEMLQMGIGGGSGGSTKNEKSKERKEK-EKDKNSMSS- 885
                  |..| |::.:.      .|.|.....||        ||..:...|:.: ::|.:|:|| 
  Fly   419 ------GGVG-SVECDP------DGTPSSPAVMG--------TKRNRVLTRQPRVKRDSDSISST 462

  Fly   886 -----------------NGSGGSANSQGGAPTSGSGPMQHSGELGPMGQLDLDLGLP------LG 927
                             |.:|.::.:.....|:||..:.|...:.....|   |.:|      ..
  Fly   463 NQISPDTAATTLDFDPFNAAGATSATARDYSTTGSHHLHHQSAVHHHHHL---LTVPPRIERHAS 524

  Fly   928 PPGGPRSNSSEPDLLSAPNAL----------------------------------FNPFNPQGFY 958
            .| .|....|.|.|||.|::.                                  .|||.|  .:
  Fly   525 EP-APSLAPSTPHLLSVPSSTPYLIKQHSDPLLPRQSALHMAGSGSGSSSAMATGSNPFAP--LH 586

  Fly   959 PDFSGGFPGLPLSMLNLLPPAERHHAAAAMHHLGVSMDEDCKSVGSKQSSSVDEDYSGPGIPLSL 1023
            ..:|....|   |..:.:.||..||.    ||  :|:.|...:.||...:. ...|..|...::.
  Fly   587 RQYSHPLSG---SNASYVTPAPLHHP----HH--ISLPESIYASGSPPPAG-SSQYLVPTRVVAC 641

  Fly  1024 EHRREISATGPPLTPSNGGTGHDXNLWRDWAA------------GAANANPMYFPAFELDQEM-- 1074
                .:.::....||:|...|....:   .||            .:|:.:|: .|.|.:..::  
  Fly   642 ----PVVSSETAATPTNASPGSSSTV---SAAVSVVTSPNAGLQNSASRHPL-SPTFSIGSDVAH 698

  Fly  1075 ---NPTPPSL------------PSRPA---------------------LHQ-LACRELSFK--PD 1100
               :|..||:            |:..|                     ||. .|....||:  |.
  Fly   699 ERRSPHSPSISRSQVVERAGKNPAEAANGGGSRLRTSKSASGSITGTHLHPGQATMSSSFEHLPT 763

  Fly  1101 LFMARRKLKRFRDKRQLQAQIETPTAAVPAPCPVSNALPPL 1141
            |.:...:|:|.....|.|.:|.|......:.|||....|.|
  Fly   764 LRVKNEELQRSVSSPQTQREIITLENPRSSHCPVIRPGPAL 804

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lovNP_611994.3 BTB 130..225 CDD:279045 42/95 (44%)
BTB 141..226 CDD:197585 38/85 (45%)
HTH_psq 791..834 CDD:283007 5/43 (12%)
BtbVIINP_647774.2 BTB 24..117 CDD:279045 43/99 (43%)
BTB 32..117 CDD:197585 38/91 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.