DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT1G68070

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_176974.1 Gene:AT1G68070 / 843135 AraportID:AT1G68070 Length:343 Species:Arabidopsis thaliana


Alignment Length:104 Identity:33/104 - (31%)
Similarity:52/104 - (50%) Gaps:16/104 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 RFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDL---DSDCCAICIEAYKPTDTIRILPC 321
            ||..|...::||..     ...::.:...:....:|:.|   |:||| ||:.:|:....:..|||
plant   252 RFHTMNNDEKQSDG-----GGKMIPVDAASENLGNERVLLPEDADCC-ICLSSYEDGAELVSLPC 310

  Fly   322 KHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEE 360
            .|.||..||..||..:.|||:||.::||       |:|:
plant   311 NHHFHSTCIVKWLKMNATCPLCKFNILK-------GNEQ 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 29/89 (33%)
RING-H2_RNF130-like 302..347 CDD:438330 20/44 (45%)
AT1G68070NP_176974.1 RING-H2_PA-TM-RING 291..333 CDD:438118 19/42 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.