| Sequence 1: | NP_001163300.1 | Gene: | gol / 38006 | FlyBaseID: | FBgn0004919 | Length: | 601 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_200027.2 | Gene: | AT5G52140 / 835290 | AraportID: | AT5G52140 | Length: | 280 | Species: | Arabidopsis thaliana |
| Alignment Length: | 49 | Identity: | 22/49 - (44%) |
|---|---|---|---|
| Similarity: | 31/49 - (63%) | Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 299 DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDV 347 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gol | NP_001163300.1 | PA_GRAIL_like | 73..217 | CDD:239037 | |
| HRD1 | <237..>347 | CDD:227568 | 21/47 (45%) | ||
| RING-H2_RNF130-like | 302..347 | CDD:438330 | 20/44 (45%) | ||
| AT5G52140 | NP_200027.2 | RING_Ubox | 230..278 | CDD:473075 | 21/47 (45%) |
| Blue background indicates that the domain is not in the aligned region. | |||||