DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RHA3B

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_195273.1 Gene:RHA3B / 829700 AraportID:AT4G35480 Length:200 Species:Arabidopsis thaliana


Alignment Length:81 Identity:31/81 - (38%)
Similarity:39/81 - (48%) Gaps:15/81 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 KKAIMKIP-------TKTGKFSDE------KDLDSDC-CAICIEAYKPTDTIRILP-CKHEFHKN 328
            |||:..:|       ..|...:|:      .|.||.. |||||..:...:.||||| |.|.||..
plant    75 KKALQALPKSTYTASASTAAAADDLPCSSVGDGDSSTECAICITEFSEGEEIRILPLCSHAFHVA 139

  Fly   329 CIDPWLIEHRTCPMCK 344
            |||.||....:||.|:
plant   140 CIDKWLTSRSSCPSCR 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 31/81 (38%)
RING-H2_RNF130-like 302..347 CDD:438330 22/45 (49%)
RHA3BNP_195273.1 RING-H2_EL5-like 112..155 CDD:438124 21/42 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.