DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT4G18110

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_193545.1 Gene:AT4G18110 / 827536 AraportID:AT4G18110 Length:213 Species:Arabidopsis thaliana


Alignment Length:62 Identity:25/62 - (40%)
Similarity:32/62 - (51%) Gaps:11/62 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 DLDSD-C-------CAICIEAYKPTDT---IRILPCKHEFHKNCIDPWLIEHRTCPMCKLDV 347
            |.||. |       |.||:|....:.:   |..|.|.|.|||:||.|||...|:||.|:.|:
plant   141 DYDSQGCLIPIEEECIICLEELASSGSERRIMKLLCSHSFHKDCILPWLRCKRSCPTCRDDI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 24/60 (40%)
RING-H2_RNF130-like 302..347 CDD:438330 21/54 (39%)
AT4G18110NP_193545.1 RING_Ubox <171..199 CDD:473075 15/27 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.