DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT4G09100

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_192649.1 Gene:AT4G09100 / 826488 AraportID:AT4G09100 Length:132 Species:Arabidopsis thaliana


Alignment Length:125 Identity:36/125 - (28%)
Similarity:61/125 - (48%) Gaps:21/125 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 FVSISFIVLMIISLVWLIFYYIQRFR--------YMQAKDQQSRNLCSVTKKAIMKIPTKTGKFS 293
            |.||.||...||:      |||:|.|        ..:|:....|....:..:||...|:..  ::
plant    15 FASIGFIAFYIIN------YYIRRCRNRAAAAGDIEEARMSPRRPPRGLDAEAIKSFPSFV--YT 71

  Fly   294 DEKDLDSDC----CAICIEAYKPTDTIRIL-PCKHEFHKNCIDPWLIEHRTCPMCKLDVL 348
            :.:.::...    |.:|:..:|..:|:|:: ||.|.||.:|:|.||....|||:|:..|:
plant    72 EARGIEPGIGELECVVCLNEFKDDETLRLVPPCVHVFHADCVDIWLSHSSTCPICRAKVV 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 35/122 (29%)
RING-H2_RNF130-like 302..347 CDD:438330 18/49 (37%)
AT4G09100NP_192649.1 RING-H2_EL5-like 84..127 CDD:438124 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.