DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and AT3G15070

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_566498.1 Gene:AT3G15070 / 820736 AraportID:AT3G15070 Length:486 Species:Arabidopsis thaliana


Alignment Length:78 Identity:30/78 - (38%)
Similarity:41/78 - (52%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 LCSVTKKAIMKIPTKTGKFSDE---KDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLI 335
            |.|...|.::|..|.|....:|   .||::|.|.||.|.||..|.|..|.|.|::|..|:..||:
plant   396 LSSEDVKELLKRRTSTRINLEEGPSTDLETDSCTICQENYKNEDKIATLDCMHKYHAECLKKWLV 460

  Fly   336 EHRTCPMCKLDVL 348
            ....||:||.:.|
plant   461 IKNVCPICKSEAL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 29/75 (39%)
RING-H2_RNF130-like 302..347 CDD:438330 19/44 (43%)
AT3G15070NP_566498.1 RING-H2_RNF24-like 426..472 CDD:438132 20/45 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.