DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and RNF181

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_005264416.1 Gene:RNF181 / 51255 HGNCID:28037 Length:187 Species:Homo sapiens


Alignment Length:61 Identity:13/61 - (21%)
Similarity:21/61 - (34%) Gaps:18/61 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 IMKIPTKTGKFSD-EKDLDSDC----CAICIEAYKPTDTIRI-------------LPCKHE 324
            :|||..:...:|. .:.:...|    |.:.....:.||.||:             .||..|
Human   108 LMKIRPRLEHYSTFLRQIPVPCAAMSCPLMTTLMRSTDEIRLENSSSNTDWRTSMEPCTRE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 13/61 (21%)
RING-H2_RNF130-like 302..347 CDD:438330 9/40 (23%)
RNF181XP_005264416.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.