| Sequence 1: | NP_001163300.1 | Gene: | gol / 38006 | FlyBaseID: | FBgn0004919 | Length: | 601 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_956600.1 | Gene: | rnf181 / 393276 | ZFINID: | ZDB-GENE-040426-1024 | Length: | 156 | Species: | Danio rerio |
| Alignment Length: | 45 | Identity: | 18/45 - (40%) |
|---|---|---|---|
| Similarity: | 32/45 - (71%) | Gaps: | 0/45 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 303 CAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDV 347 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gol | NP_001163300.1 | PA_GRAIL_like | 73..217 | CDD:239037 | |
| HRD1 | <237..>347 | CDD:227568 | 18/43 (42%) | ||
| RING-H2_RNF130-like | 302..347 | CDD:438330 | 18/43 (42%) | ||
| rnf181 | NP_956600.1 | RING-H2_RNF181 | 78..123 | CDD:438331 | 18/43 (42%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 135..156 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||