DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and CG14435

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_572359.2 Gene:CG14435 / 31628 FlyBaseID:FBgn0029911 Length:303 Species:Drosophila melanogaster


Alignment Length:54 Identity:24/54 - (44%)
Similarity:31/54 - (57%) Gaps:3/54 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 KFSDEKDLDSDC---CAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCP 341
            :.|..:|:.||.   |.||:|...|.|||..|||...:||.|||.|...:|:||
  Fly   245 RLSYNEDVLSDAKGECVICLEDLSPGDTIARLPCLCIYHKGCIDRWFEVNRSCP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 24/54 (44%)
RING-H2_RNF130-like 302..347 CDD:438330 20/43 (47%)
CG14435NP_572359.2 mRING-CH-C4HC2H_ZNRF2 248..303 CDD:438356 23/51 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.