DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and rnf-126

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_491091.1 Gene:rnf-126 / 171875 WormBaseID:WBGene00021842 Length:304 Species:Caenorhabditis elegans


Alignment Length:63 Identity:21/63 - (33%)
Similarity:33/63 - (52%) Gaps:2/63 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 IPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDV 347
            :|.|  |.:.|...:...|..|.:.:|..:.:..|.|.|.||:.||:|||....:||:|:..|
 Worm   222 LPMK--KVTQEHIDNGAQCTTCFDTFKLDEDVGALDCNHIFHRPCIEPWLKTKNSCPVCRQKV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 20/61 (33%)
RING-H2_RNF130-like 302..347 CDD:438330 16/44 (36%)
rnf-126NP_491091.1 zinc_ribbon_9 3..34 CDD:433910
RING-H2_PA-TM-RING 237..279 CDD:438118 15/41 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.