DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and mura

DIOPT Version :10

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_061505256.1 Gene:mura / 1281824 VectorBaseID:AGAMI1_003466 Length:869 Species:Anopheles gambiae


Alignment Length:85 Identity:29/85 - (34%)
Similarity:48/85 - (56%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 VTKKAIMKIPTKTGKFSDEKDL-DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTC 340
            :.:..|.::|:.  ||:.|... |...|.:|:..::....:|:|||.||||..|:|.||..:|||
Mosquito   790 LARPEIDQLPSY--KFNAETHTGDQTSCVVCMCDFEARQILRVLPCSHEFHAKCVDKWLRSNRTC 852

  Fly   341 PMCKLDVLKFYGYVFLGSEE 360
            |:|:.:..::    |..|||
Mosquito   853 PICRGNASEY----FESSEE 868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037
HRD1 <237..>347 CDD:227568 25/70 (36%)
RING-H2_RNF130-like 302..347 CDD:438330 19/44 (43%)
muraXP_061505256.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.