DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zip and MYA2

Sequence 1:NP_523860.2 Gene:zip FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster
Sequence 2:NP_001190465.1 Gene:MYA2 AraportID:AT5G43900 Length:1565 Species:Arabidopsis thaliana

Alignment Length:1222 Identity:386/1223 (32%)
Similarity:627/1223 (51%) Gaps:183/1223 (15%)


  Fly    82 VWVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDIQKMNPPKFDK----VEDMAELTCL 142
            |||...::.::...:.:.:|||::| |..:||.|:   ..|....|...:.    |:||..|..|
plant    73 VWVEDPDEAWIDGEVVQVNGDEIKV-LCTSGKHVV---TKISNAYPKDVEAPASGVDDMTRLAYL 133

  Fly   143 NEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLP-IYTEKIMERYKGIKRHEVPPHVFAITDS 206
            :|..||.|:..||....||||:|...:.|||:::|| :|:..:|.:|||....|:.||.||:.|:
plant   134 HEPGVLQNLHSRYDINEIYTYTGSILIAVNPFRRLPHLYSSHMMAQYKGASLGELSPHPFAVADA 198

  Fly   207 AYRNMLGDREDQSILCTGESGAGKTENTKKVIQFLAYVAASKPKGSGAVPHPAVLINFSVNTNKY 271
            |||.|:.|...||||.:|||||||||:||.::::|||:.     |..|.                
plant   199 AYRQMINDGVSQSILVSGESGAGKTESTKLLMRYLAYMG-----GRAAA---------------- 242

  Fly   272 IKVKIMAQNQNQTIEVVNGLKMVEVNSNCQEG-ELEQQLLQANPILEAFGNAKTVKNDNSSRFGK 335
                                          || .:||::|::||:||||||||||:|:|||||||
plant   243 ------------------------------EGRSVEQKVLESNPVLEAFGNAKTVRNNNSSRFGK 277

  Fly   336 FIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHIFYQLLAGATPEQREKFILDDVKSYAF 400
            |:.|.||..|.||||.|.|||||:||..:.:..||.:|.||.|.| |..|..:||.|::.|.|.:
plant   278 FVEIQFDEKGRISGAAIRTYLLERSRVCQVSDPERNYHCFYMLCA-APQEDVKKFKLEEPKKYHY 341

  Fly   401 LSNGS-LPVPGVDDYAEFQATVKSMNIMGMTSEDFNSIFRIVSAVLLFGSMKFRQERNNDQATLP 464
            |:... |.:..::|..|:.||.::|:::|:::|:.::||.:|:|:|..|:::|.:....|.:...
plant   342 LNQSKCLELDSINDAEEYHATRRAMDVVGISTEEQDAIFSVVAAILHIGNIEFAKGEEIDSSIPK 406

  Fly   465 DNTV---AQKIAHLLGLSVTDMTRAFLTPRIKVGRD-FVTKAQTKEQVEFAVEAIAKACYERMFK 525
            |:..   .:..|.||......:..: |..||.|.|| .:||....|....:.:|:||..|.|:|.
plant   407 DDKSLFHLKTAAELLSCDEKALEDS-LCKRIMVTRDETITKTLDPEAATLSRDALAKVMYSRLFD 470

  Fly   526 WLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEY 590
            |||::||.|:.: .......||:||:.|||.|:.|||||.|||.|||||||.||..:|.:|||||
plant   471 WLVDKINSSIGQ-DHDSKYLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEY 534

  Fly   591 QREGIEWKFIDFGLDLQPTIDLID-KPGGIMALLDEECWFPKATDKTFVDKLVSAHSMHPKFMKT 654
            ::|.|.|.:|:| :|.|..:|||: |||||:|||||.|.||::|.:||..||......|.:|.|.
plant   535 KKEEINWSYIEF-VDNQDILDLIEKKPGGIIALLDEACMFPRSTHETFAQKLYQTFKTHKRFTKP 598

  Fly   655 DFRGVADFAIVHYAGRVDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVVNIWKDAEIVGMAQQAL 719
            .. ..:||.|.||||.|.|....:|.||.|.:.....:||..|...||.:::          ..:
plant   599 KL-ARSDFTICHYAGDVTYQTELFLDKNKDYVIAEHQALLNSSSCSFVASLF----------PPM 652

  Fly   720 TDTQFGARTRKGMFRTVSHLYKEQLAKLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRC 784
            :|.     :::..|.::...:|:||..|::.|..|.|:::|||.||:..:.|..:...:|.||||
plant   653 SDD-----SKQSKFSSIGTRFKQQLVSLLEILNTTEPHYIRCIKPNNLLKPGIFENENILQQLRC 712

  Fly   785 NGVLEGIRICRQGFPNRIPFQEFRQRYELLTPNVIPKGFMDGKKACEKMIQALELDSNLYRVGQS 849
            .||:|.|||...|:|.|..|.||..|:.:|.|.|:.|. .|...||:|::..:.|:.  |::|::
plant   713 GGVMEAIRISCAGYPTRKHFDEFLARFGILAPEVLVKN-SDDPAACKKLLDKVGLEG--YQIGKT 774

  Fly   850 KIFFRAGVLAHLEEERD------------------FKISDLIV-----NFQAFCRGFLARRNYQK 891
            |:|.|||.:|.|:..|.                  .|.|.:::     ..|:.|||:|||..|:.
plant   775 KVFLRAGQMADLDTRRTEVLGRSASIIQRKVRSYLAKKSFIVLRNSAKQIQSVCRGYLARSVYEG 839

  Fly   892 RLQQLNAIRIIQRNCAAYLKLRNWQWWRLYTKV-KPLLEVTKQEEKLVQKEDELKQVREKLDTLA 955
            ..::..|:: |||:      ||.:...:.||:: ...:.|......:|.:::...:.:.|...:.
plant   840 MRREAAALK-IQRD------LRRFLARKAYTELYSAAVSVQAGMRGMVARKELCFRRQTKAAIII 897

  Fly   956 KN------TQEYERKYQQALVEKTT----LAEQLQAEIELCAEAEESRSRLMARKQELEDMMQEL 1010
            :.      .:.:.||.::|.:  ||    .::..:.|:.....|......|.|.|.:||..::||
plant   898 QTWCRGYLARLHYRKLKKAAI--TTQCAWRSKVARGELRKLKMAARETGALQAAKNKLEKQVEEL 960

  Fly  1011 ETRIEEEEERVLALGGEKKKLELNIQ-DLEEQLEEEEAARQKLQLEKVQLDAK------IKKYEE 1068
            ..|::               ||..|: |||| .:::|:|:.:..||::||..|      ||  |.
plant   961 TWRLQ---------------LEKRIRTDLEE-AKKQESAKAQSSLEELQLKCKETEALLIK--ER 1007

  Fly  1069 DLALTDDQNQKLLKEKKLLEERANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKDQQQR 1133
            :.|....:...::||..::::   :|...:..|.||.|.:          :|.||.::.:.:::.
plant  1008 EAAKKIAETAPIIKEIPVVDQ---ELMDKITNENEKLKSM----------VSSLEMKIGETEKKL 1059

  Fly  1134 QES-----DRSKRKIETE--VADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRID----EESA 1187
            ||:     ||..:.:|.|  :..||..:.....::.:|:|:.....::...|.:|.:    ..:.
plant  1060 QETTKISQDRLNQALEAESKLVKLKTAMQRLEEKILDMEAEKKIMHQQTISTPVRTNLGHPPTAP 1124

  Fly  1188 TKATAQKAQRELESQLAEIQEDLEAE-KAARAKAEKVRRDLSEELEALKNEL 1238
            .|......|..||.:..|.:.....: ||.::.||:...::...::.:|:.:
plant  1125 VKNLENGHQTNLEKEFNEAEFTTPVDGKAGKSAAERQIMNVDALIDCVKDNI 1176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zipNP_523860.2 Myosin_N 80..117 CDD:280832 11/35 (31%)
Myosin_head 133..854 CDD:278492 281/729 (39%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 275/717 (38%)
Myosin_tail_1 931..2011 CDD:279860 67/338 (20%)
Prefoldin 1431..1515 CDD:298833
FAM76 <1847..1926 CDD:292665
MYA2NP_001190465.1 Myosin_N 73..108 CDD:280832 11/39 (28%)
MYSc 117..790 CDD:214580 286/747 (38%)
MYSc_Myo11 136..779 CDD:276835 275/717 (38%)
IQ 889..911 CDD:197470 1/22 (5%)
RILP-like 964..1083 CDD:304877 34/150 (23%)
MyosinXI_CBD 1159..1535 CDD:271259 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126577
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.